![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gorai.009G115000.5 | ||||||||
| Common Name | B456_009G115000, LOC105767978 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 118aa MW: 13085.7 Da PI: 10.6754 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 107 | 1.6e-33 | 22 | 78 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep++VNaKQy++Il+RRq+Rak+e+e+kl +ksrkpylheSRh hAlrR+RgsgGrF
Gorai.009G115000.5 22 EEPVFVNAKQYHGILRRRQSRAKAESENKL-AKSRKPYLHESRHLHALRRARGSGGRF 78
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 1.4E-36 | 20 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 38.039 | 21 | 81 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 1.1E-28 | 23 | 78 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 3.1E-24 | 24 | 46 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 26 | 46 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 3.1E-24 | 55 | 78 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MVHLQLMGIQ QAGVPLPSDA VEEPVFVNAK QYHGILRRRQ SRAKAESENK LAKSRKPYLH 60 ESRHLHALRR ARGSGGRFLN SKKNENKQNE AAPSDKSQSN INLNSDKNEL ASTEGNC* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 3e-23 | 21 | 86 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM422775 | 5e-61 | AM422775.1 Antirrhinum majus mRNA for YA6 (nf-YA gene). | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012443082.1 | 3e-81 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Refseq | XP_012443083.1 | 3e-81 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Refseq | XP_012443084.1 | 3e-81 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Refseq | XP_012443085.1 | 3e-81 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Refseq | XP_016688766.1 | 3e-81 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Refseq | XP_016688767.1 | 3e-81 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
| Swissprot | Q84JP1 | 4e-51 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | A0A0D2Q4N4 | 6e-80 | A0A0D2Q4N4_GOSRA; Uncharacterized protein | ||||
| TrEMBL | A0A0D2RQ52 | 4e-80 | A0A0D2RQ52_GOSRA; Uncharacterized protein | ||||
| TrEMBL | A0A1U8JEL5 | 6e-80 | A0A1U8JEL5_GOSHI; nuclear transcription factor Y subunit A-7-like | ||||
| TrEMBL | A0A2P5QSQ2 | 6e-80 | A0A2P5QSQ2_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.009G115000.1 | 1e-80 | (Gossypium raimondii) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.2 | 1e-53 | nuclear factor Y, subunit A7 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Gorai.009G115000.5 |
| Entrez Gene | 105767978 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




