![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gorai.009G284200.1 | ||||||||
| Common Name | B456_009G284200 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 94aa MW: 10780.5 Da PI: 8.7159 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 43.8 | 3.3e-14 | 2 | 41 | 3 | 42 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
ien+ vtfskRr gi KK +EL++LC+ ++ iifs
Gorai.009G284200.1 2 IENEDDWLVTFSKRRLGIYKKKSELCTLCGNNIFFIIFSF 41
89999999******************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 15.853 | 1 | 52 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.2E-7 | 1 | 51 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.3E-15 | 2 | 48 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.19E-16 | 2 | 62 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.6E-5 | 14 | 29 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.6E-5 | 29 | 50 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 94 aa Download sequence Send to blast |
MIENEDDWLV TFSKRRLGIY KKKSELCTLC GNNIFFIIFS FARKPFAYGH PSIESIANHF 60 LNGNISVIDN TPALIEAHRT ARIYKLIQLY NEV* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in the final stages of embryo sac development. {ECO:0000269|PubMed:18713950}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed exclusively in the central cell of the female gametophyte and in early endosperm. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016684251.1 | 3e-42 | PREDICTED: agamous-like MADS-box protein AGL62 | ||||
| Swissprot | Q4PSU4 | 3e-19 | AGL61_ARATH; Agamous-like MADS-box protein AGL61 | ||||
| TrEMBL | A0A0D2QPN3 | 8e-63 | A0A0D2QPN3_GOSRA; Uncharacterized protein | ||||
| STRING | Gorai.009G284200.1 | 1e-63 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM86 | 28 | 390 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G29962.1 | 9e-22 | AGAMOUS-like 64 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Gorai.009G284200.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




