PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.009G288000.6

Common Name

B456_009G288000

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MIKC_MADS

Protein Properties

Length: 172aa MW: 19997.9 Da PI: 10.2311

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.009G288000.6	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100	9.2e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyeys+ Gorai.009G288000.6 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYSN 59 79***********************************************95 PP
2	K-box	107.1	2.1e-35	77	170	4	97
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 s+++ ++e +a+++qqe+akL+++i++Lq++ Rhl+G++L+sL++keL+qLe++Le+++++iRskK+e+ll++ie+ qk+e el++e +L Gorai.009G288000.6 77 SNTNTVTEINAQYYQQESAKLRQQIQMLQNSSRHLMGDSLSSLTVKELKQLENRLERGITRIRSKKHEMLLAEIEYFQKREVELENESVCL 167 5556699************************************************************************************ PP K-box 95 rkk 97 r+k Gorai.009G288000.6 168 RAK 170 987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.95	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.1E-41	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.75E-33	2	83	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.97E-42	2	75	No hit	No description
PRINTS	PR00404	5.2E-33	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.1E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.2E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.2E-33	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	5.8E-26	86	170	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	14.289	87	171	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0090376	Biological Process	seed trichome differentiation
GO:0005634	Cellular Component	nucleus
GO:0016021	Cellular Component	integral component of membrane
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 172 aa Download sequence Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFST RGRLYEYSNN 60 NIRSTIERYK KACSGTSNTN TVTEINAQYY QQESAKLRQQ IQMLQNSSRH LMGDSLSSLT 120 VKELKQLENR LERGITRIRS KKHEMLLAEI EYFQKREVEL ENESVCLRAK R*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6bz1_A	1e-21	1	82	1	83	MEF2 CHIMERA
6bz1_B	1e-21	1	82	1	83	MEF2 CHIMERA
6bz1_C	1e-21	1	82	1	83	MEF2 CHIMERA
6bz1_D	1e-21	1	82	1	83	MEF2 CHIMERA
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in flowers and seeds (Ref.1). Expressed in endotesta cell layer of developing seeds (PubMed:28369525). {ECO:0000269\|PubMed:28369525, ECO:0000269\|Ref.1}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in seed development. {ECO:0000269\|PubMed:29853599}.
UniProt	Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269\|PubMed:21447172, ECO:0000269\|PubMed:29853599, ECO:0000269\|Ref.1}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EF190548	0.0	EF190548.1 Gossypium hirsutum MADS-box protein MADS5 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001314587.1	1e-120	agamous-like MADS-box protein AGL11
Refseq	XP_016686909.1	1e-120	PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
Refseq	XP_016686910.1	1e-120	PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
Refseq	XP_016686911.1	1e-120	PREDICTED: agamous-like MADS-box protein AGL11 isoform X2
Refseq	XP_016686914.1	1e-120	PREDICTED: agamous-like MADS-box protein AGL11 isoform X2
Refseq	XP_016748505.1	1e-120	PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
Refseq	XP_016748506.1	1e-120	PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
Refseq	XP_016748507.1	1e-120	PREDICTED: agamous-like MADS-box protein AGL11 isoform X2
Swissprot	A0A217EJJ0	1e-106	AG11S_VITVI; Agamous-like MADS-box protein AGL11
Swissprot	F6I457	1e-106	AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBL	A0A0D2TTM2	1e-119	A0A0D2TTM2_GOSRA; Uncharacterized protein
STRING	Gorai.009G288000.1	1e-119	(Gossypium raimondii)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.1	1e-103	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Gorai.009G288000.6

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Mejía N, et al. Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine. BMC Plant Biol., 2011. 11: p. 57 [PMID:21447172] Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Malabarba J, et al. The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine. J. Exp. Bot., 2017. 68(7): p. 1493-1506 [PMID:28369525] Royo C, et al. The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11. Plant Physiol., 2018. 177(3): p. 1234-1253 [PMID:29853599]