PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.010G098000.1

Common Name

B456_010G098000, LOC105772703

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

WRKY

Protein Properties

Length: 158aa MW: 18421.1 Da PI: 4.8098

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.010G098000.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	99	3e-31	96	154	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K vk+s++pr+YYrC+ gCpvkk+ver++edp++v++tYeg Hnh+ Gorai.010G098000.1 96 LDDGYRWRKYGKKWVKNSPNPRNYYRCSIDGCPVKKRVERDKEDPSYVITTYEGIHNHR 154 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	9.0E-34	83	155	IPR003657	WRKY domain
SuperFamily	SSF118290	1.1E-28	89	154	IPR003657	WRKY domain
PROSITE profile	PS50811	29.918	91	156	IPR003657	WRKY domain
SMART	SM00774	1.3E-35	96	155	IPR003657	WRKY domain
Pfam	PF03106	8.5E-25	97	154	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009867	Biological Process	jasmonic acid mediated signaling pathway
GO:0050832	Biological Process	defense response to fungus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 158 aa Download sequence Send to blast
MSSSNFNPPD SPESDRADQS NFEFPEDWTL DGWLEDYPET IITGPIQFPF NQADEVNNDS 60 ARTSSLLQVS ENETARERRD VRERFAFKTK SEVEILDDGY RWRKYGKKWV KNSPNPRNYY 120 RCSIDGCPVK KRVERDKEDP SYVITTYEGI HNHRSVS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-26	86	153	7	74	Probable WRKY transcription factor 4
2lex_A	2e-26	86	153	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00531	DAP	Transfer from AT5G26170	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF031085	0.0	KF031085.1 Gossypium hirsutum WRKY transcription factor 38 (WRKY38) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012449571.1	1e-114	PREDICTED: probable WRKY transcription factor 50
Refseq	XP_016699617.1	1e-114	PREDICTED: probable WRKY transcription factor 50
Swissprot	Q8VWQ5	4e-43	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	A0A059Q7A1	1e-112	A0A059Q7A1_GOSHI; WRKY transcription factor 38
TrEMBL	A0A0D2SQE6	1e-112	A0A0D2SQE6_GOSRA; Uncharacterized protein
STRING	Gorai.010G098000.1	1e-113	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6121	27	47

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G26170.1	1e-45	WRKY DNA-binding protein 50

Link Out ? help Back to Top
Phytozome	Gorai.010G098000.1
Entrez Gene	105772703

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886]