![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gorai.011G120200.1 | ||||||||
| Common Name | B456_011G120200 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 96aa MW: 11092.1 Da PI: 10.7333 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 57 | 4.3e-18 | 27 | 73 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g WT +Ed +l+++vkq+G + W+ Ia+ + gR +kqc++rw+++l
Gorai.011G120200.1 27 KGQWTDDEDRKLIRLVKQYGVRKWAQIAESLV-GRAGKQCRERWHNHL 73
799*****************************.*************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 5.9E-24 | 19 | 80 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 28.006 | 22 | 77 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 3.11E-19 | 24 | 79 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 2.0E-16 | 26 | 75 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.73E-14 | 30 | 73 | No hit | No description |
| Pfam | PF13921 | 3.2E-17 | 30 | 83 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MKASMKGDFP KWVVKRNTKV ASAALIKGQW TDDEDRKLIR LVKQYGVRKW AQIAESLVGR 60 AGKQCRERWH NHLRPNIKEM QCLASTLCMP LWIEL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 9e-20 | 25 | 78 | 5 | 58 | B-MYB |
| 1h88_C | 1e-19 | 19 | 78 | 50 | 109 | MYB PROTO-ONCOGENE PROTEIN |
| 1h89_C | 1e-19 | 19 | 78 | 50 | 109 | MYB PROTO-ONCOGENE PROTEIN |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During female gametogenesis, expressed in the female gametophyte at stage FG4 (four-nucleate stage) in all four nuclei. Expressed in the central cell in unfused polar nuclei at stage FG5 and secondary nucleus at stage FG6. Not expressed in mature female gametophytes (stage FG7). {ECO:0000269|PubMed:24068955}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in ovary septum and stamen filament. {ECO:0000269|PubMed:24068955}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor required for female gametophyte fertility. Acts redundantly with MYB64 to initiate the FG5 transition during female gametophyte development. The FG5 transition represents the switch between free nuclear divisions and cellularization-differentiation in female gametophyte, and occurs during developmental stage FG5. {ECO:0000269|PubMed:24068955}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012454624.1 | 2e-48 | PREDICTED: transcription factor MYB44-like isoform X2 | ||||
| Swissprot | Q9FIM4 | 2e-26 | MY119_ARATH; Transcription factor MYB119 | ||||
| TrEMBL | A0A0D2T6S5 | 5e-64 | A0A0D2T6S5_GOSRA; Uncharacterized protein | ||||
| STRING | Gorai.011G120200.1 | 8e-65 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM27405 | 3 | 3 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G58850.1 | 1e-28 | myb domain protein 119 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Gorai.011G120200.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




