PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.011G189100.1

Common Name

B456_011G189100

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

NF-YB

Protein Properties

Length: 129aa MW: 14212.2 Da PI: 6.5949

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.011G189100.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	158.8	8.7e-50	17	105	2	90
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 reqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvtseasdkc++e+rkting+d++walatlGf+dy++pl+ yl+k Gorai.011G189100.1 17 REQDRLLPIANVGRIMKQMLPPNAKISKEAKETMQECVSEFISFVTSEASDKCRKERRKTINGEDICWALATLGFDDYAAPLRRYLNKL 105 89************************************************************************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	5.0E-49	12	114	IPR009072	Histone-fold
SuperFamily	SSF47113	6.52E-37	19	120	IPR009072	Histone-fold
Pfam	PF00808	2.2E-28	22	86	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.3E-16	50	68	No hit	No description
PROSITE pattern	PS00685	0	53	69	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.3E-16	69	87	No hit	No description
PRINTS	PR00615	1.3E-16	88	106	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 129 aa Download sequence Send to blast
MAENVGGSGS NDDDGFREQD RLLPIANVGR IMKQMLPPNA KISKEAKETM QECVSEFISF 60 VTSEASDKCR KERRKTINGE DICWALATLG FDDYAAPLRR YLNKLITTTV MKASMIGSSR 120 NSNLGPFD*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	8e-42	17	104	2	89	Transcription factor HapC (Eurofung)
4g92_B	8e-42	17	104	2	89	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012453013.1	2e-73	PREDICTED: nuclear transcription factor Y subunit B-1-like
Refseq	XP_016700599.1	2e-73	PREDICTED: nuclear transcription factor Y subunit B-1-like
Swissprot	O82248	5e-51	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A0D2TAA9	1e-90	A0A0D2TAA9_GOSRA; Uncharacterized protein
STRING	Gorai.011G189100.1	2e-91	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	1e-53	nuclear factor Y, subunit B5

Link Out ? help Back to Top
Phytozome	Gorai.011G189100.1

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]