PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gorai.012G061800.1

Common Name

B456_012G061800, LOC105778805

Organism

Gossypium raimondii

Taxonomic ID

29730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB

Protein Properties

Length: 220aa MW: 25399.6 Da PI: 7.7141

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gorai.012G061800.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	61	2.6e-19	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd+ll+d+vk +G+g+W++Ia++ g++R++k+c++rw +yl Gorai.012G061800.1 13 KGLWTMEEDKLLIDYVKVHGKGQWNKIANRTGLKRSGKSCRLRWMNYL 60 678*******************************************97 PP
2	Myb_DNA-binding	59.5	7.1e-19	66	111	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g +++eE++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l Gorai.012G061800.1 66 KGDFSEEEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNYWNSHL 111 689*****************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.04	1	60	IPR017930	Myb domain
SuperFamily	SSF46689	1.34E-31	12	107	IPR009057	Homeodomain-like
SMART	SM00717	1.7E-15	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	6.2E-18	13	60	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.2E-24	14	67	IPR009057	Homeodomain-like
CDD	cd00167	3.43E-12	16	60	No hit	No description
PROSITE profile	PS51294	29.028	61	115	IPR017930	Myb domain
SMART	SM00717	6.6E-19	65	113	IPR001005	SANT/Myb domain
Pfam	PF00249	4.8E-18	66	111	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	9.5E-28	68	115	IPR009057	Homeodomain-like
CDD	cd00167	3.53E-13	69	111	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048765	Biological Process	root hair cell differentiation
GO:0090377	Biological Process	seed trichome initiation
GO:0090378	Biological Process	seed trichome elongation
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 220 aa Download sequence Send to blast
MSMKKEGEIL YKKGLWTMEE DKLLIDYVKV HGKGQWNKIA NRTGLKRSGK SCRLRWMNYL 60 SPNVKKGDFS EEEEDLIIRL HKLLGNRWSL IAKRVPGRTD NQVKNYWNSH LRKKLGIIDQ 120 NETRIDFCQS SKQVKVCHVD EAATDPSPGH GTTTETTGIT VDQSNQQEAI DHRVLNNTTQ 180 ESMTSESYIN TFWIPDHDYE LSTLAMIDHF HEYSSFHLS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-30	13	115	7	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269\|PubMed:10589676, ECO:0000269\|PubMed:14627722, ECO:0000269\|PubMed:16207757}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269\|PubMed:10589676, ECO:0000269\|PubMed:11585796, ECO:0000269\|PubMed:14627722, ECO:0000269\|PubMed:15361138, ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16207757}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:16176989}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KT751523	0.0	KT751523.1 Gossypium hirsutum MYB109 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012458020.1	1e-165	PREDICTED: transcription factor WER
Swissprot	Q9SEI0	2e-73	WER_ARATH; Transcription factor WER
TrEMBL	A0A0D2V2L3	1e-164	A0A0D2V2L3_GOSRA; Uncharacterized protein
STRING	Gorai.012G061800.1	1e-164	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G14750.1	2e-75	myb domain protein 66

Link Out ? help Back to Top
Phytozome	Gorai.012G061800.1
Entrez Gene	105778805

Publications ? help Back to Top
Paterson AH, et al. Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres. Nature, 2012. 492(7429): p. 423-7 [PMID:23257886] Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Cheng Y, et al. Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases. Elife, 2018. [PMID:24771765] Kiefer CS, et al. Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity. Development, 2015. 142(5): p. 1022 [PMID:25715402] Kwak SH,Song SK,Lee MM,Schiefelbein J TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(12): p. e1103407 [PMID:26451798] Zhu Y, et al. The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development. Plant Cell, 2017. 29(2): p. 260-276 [PMID:28138017] Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] Mira MM, et al. Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit. J. Exp. Bot., 2017. 68(20): p. 5653-5668 [PMID:29059380] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308]