![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gorai.012G090600.1 | ||||||||
| Common Name | B456_012G090600 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 79aa MW: 9162.07 Da PI: 11.3195 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 44.2 | 2.5e-14 | 16 | 50 | 8 | 42 |
HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
SRF-TF 8 nrqvtfskRrngilKKAeELSvLCdaevaviifss 42
rq + kR+ gilKKA+ELS+L d+ev +++ s+
Gorai.012G090600.1 16 ARQAKYLKRKRGILKKAKELSILFDVEVVLLLSST 50
69999***********************9998775 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 17.759 | 1 | 50 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.7E-13 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 7.59E-18 | 1 | 63 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00120 | 1.25E-12 | 2 | 58 | No hit | No description |
| PRINTS | PR00404 | 1.1E-10 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.7E-12 | 15 | 54 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-10 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-10 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 79 aa Download sequence Send to blast |
MGRIKLKIQR LEIMKARQAK YLKRKRGILK KAKELSILFD VEVVLLLSST FTKPTFFCWS 60 RPREGLYNGG MSRYPVLN* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012448418.1 | 8e-23 | PREDICTED: truncated transcription factor CAULIFLOWER A-like | ||||
| Refseq | XP_016681153.1 | 1e-23 | PREDICTED: agamous-like MADS-box protein AGL65 | ||||
| Swissprot | Q7X9I0 | 7e-15 | AGL65_ARATH; Agamous-like MADS-box protein AGL65 | ||||
| TrEMBL | A0A0D2RWR8 | 3e-49 | A0A0D2RWR8_GOSRA; Uncharacterized protein | ||||
| STRING | Gorai.012G090600.1 | 5e-50 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7330 | 18 | 38 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G18750.1 | 3e-17 | AGAMOUS-like 65 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Gorai.012G090600.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




