![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gorai.012G155000.1 | ||||||||
| Common Name | B456_012G155000 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 168aa MW: 19664.2 Da PI: 6.6337 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 41.4 | 3.1e-13 | 38 | 94 | 7 | 63 |
HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
+r+++NRe+ArrsR RK++ ++ L + +L+++N++ + +++ +++ +++se+
Gorai.012G155000.1 38 RKRMISNRESARRSRMRKQKHLDDLMTQLTQLQKQNHEIITNINFTTQHLLNVESEN 94
69***************************************9999999988888877 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 3.2E-13 | 37 | 96 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 9.381 | 37 | 97 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 4.75E-12 | 37 | 88 | No hit | No description |
| Pfam | PF00170 | 6.4E-10 | 37 | 83 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14702 | 3.72E-20 | 37 | 87 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 3.0E-10 | 38 | 111 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 39 | 54 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 168 aa Download sequence Send to blast |
MFPILSEIFF SGFMINSTFI RRTHLVQSFS VVFLYWKRKR MISNRESARR SRMRKQKHLD 60 DLMTQLTQLQ KQNHEIITNI NFTTQHLLNV ESENSVLRAQ LNELTHRLQS LNEIISFLND 120 DHGDDDDDDD KTSIDFTQPA VADNIFLNPF HLAYLNQPIM ASADYKT* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 48 | 55 | RRSRMRKQ |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Highly expressed in stems and flowers (PubMed:9620274). Expressed in root tips, cotyledons, leaf vasculature, embryos, apical parts of siliques and funiculi (PubMed:9721683). {ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JX964038 | 3e-54 | JX964038.1 Gossypium hirsutum clone NBRI_TRANS-307 microsatellite sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012458339.1 | 1e-88 | PREDICTED: ocs element-binding factor 1-like | ||||
| Swissprot | O65683 | 1e-39 | BZP11_ARATH; bZIP transcription factor 11 | ||||
| TrEMBL | A0A0D2V5R4 | 1e-115 | A0A0D2V5R4_GOSRA; Uncharacterized protein (Fragment) | ||||
| STRING | Gorai.012G155000.1 | 1e-120 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM501 | 28 | 154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G34590.1 | 1e-35 | G-box binding factor 6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Gorai.012G155000.1 |




