![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gorai.013G077400.11 | ||||||||
| Common Name | B456_013G077400 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 162aa MW: 18063.7 Da PI: 10.3937 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 72.5 | 7e-23 | 93 | 145 | 1 | 53 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkq 53
s+yk+kaal+v++++p+f+ ldsg++k++r+G++ll++a+a+++r+ydW++kq
Gorai.013G077400.11 93 SIYKGKAALTVEPRAPEFVPLDSGAFKISREGFVLLQFAPAAGVRQYDWSRKQ 145
7***************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.30.31.10 | 1.9E-25 | 85 | 146 | IPR009044 | ssDNA-binding transcriptional regulator |
| SuperFamily | SSF54447 | 4.55E-23 | 87 | 145 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 5.1E-20 | 94 | 146 | IPR013742 | Plant transcription factor |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006281 | Biological Process | DNA repair | ||||
| GO:0032211 | Biological Process | negative regulation of telomere maintenance via telomerase | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0045910 | Biological Process | negative regulation of DNA recombination | ||||
| GO:0009508 | Cellular Component | plastid chromosome | ||||
| GO:0009570 | Cellular Component | chloroplast stroma | ||||
| GO:0003697 | Molecular Function | single-stranded DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0003723 | Molecular Function | RNA binding | ||||
| GO:0042162 | Molecular Function | telomeric DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 162 aa Download sequence Send to blast |
MLQLQLLSSP PLTPQTLNLN SISNPKLFPS FSSLNSSQTR SFKFNPLSKP SKFSLKCRQS 60 EYFDQKQRFN DSSSSTSPSS LAGLPARFYV GHSIYKGKAA LTVEPRAPEF VPLDSGAFKI 120 SREGFVLLQF APAAGVRQYD WSRKQIKCKI FVVKDEYVLE T* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4koo_A | 9e-36 | 83 | 146 | 4 | 67 | Single-stranded DNA-binding protein WHY1, chloroplastic |
| 4koo_B | 9e-36 | 83 | 146 | 4 | 67 | Single-stranded DNA-binding protein WHY1, chloroplastic |
| 4koo_C | 9e-36 | 83 | 146 | 4 | 67 | Single-stranded DNA-binding protein WHY1, chloroplastic |
| 4koo_D | 9e-36 | 83 | 146 | 4 | 67 | Single-stranded DNA-binding protein WHY1, chloroplastic |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gra.556 | 0.0 | seedling | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 48746181 | 0.0 | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that functions in both chloroplasts and nucleus. In chloroplasts, maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. In nucleus, modulates telomere length homeostasis by inhibiting the action of the telomerase at the extreme termini of chromosomes. Is recruited to a distal element upstream of the kinesin KP1 to mediate the transcriptional repression of KP1. Is required for full salicylic acid-dependent plant disease resistance responses. Can bind double-stranded DNA in vivo. {ECO:0000269|PubMed:14960277, ECO:0000269|PubMed:17217467, ECO:0000269|PubMed:19666500, ECO:0000269|PubMed:19669906, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:21911368}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By salicylic acid (SA) and infection by H.parasitica. {ECO:0000269|PubMed:14960277, ECO:0000269|PubMed:19669906}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JX617609 | 4e-90 | JX617609.1 Gossypium hirsutum clone NBRI_GE62797 microsatellite sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012463277.1 | 1e-100 | PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like isoform X3 | ||||
| Swissprot | Q9M9S3 | 7e-48 | WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
| TrEMBL | A0A0D2SAE1 | 1e-112 | A0A0D2SAE1_GOSRA; Uncharacterized protein | ||||
| STRING | Gorai.013G077400.1 | 2e-99 | (Gossypium raimondii) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G14410.1 | 2e-44 | ssDNA-binding transcriptional regulator | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Gorai.013G077400.11 |




