![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Gorai.013G191800.1 | ||||||||
| Common Name | B456_013G191800 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 167aa MW: 19071.8 Da PI: 10.3068 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 169.7 | 9.3e-53 | 8 | 142 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91
lppGfrFhPtdeel+ +yL kk++++++++ ++i++vdiyk++PwdLp k+ +ekewyfFs+rd+ky++g r+nra+ sgyWkatg+dk
Gorai.013G191800.1 8 LPPGFRFHPTDEELILHYLMKKLSSSPFPV-SIIADVDIYKFDPWDLPDKAVFGEKEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKI 97
79****************************.89***************7777899************************************ PP
NAM 92 vlsk..kgel........vglkktLvfykgrapkgektdWvmheyrl 128
++++ + +g+kk Lvfykgr pkg kt+W+mheyrl
Gorai.013G191800.1 98 IVASsmA--AgrggvfsnIGVKKALVFYKGRPPKGIKTNWIMHEYRL 142
**97550..355566778***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.02E-60 | 4 | 149 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 55.822 | 8 | 167 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.1E-27 | 9 | 142 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 167 aa Download sequence Send to blast |
MRLPHSSLPP GFRFHPTDEE LILHYLMKKL SSSPFPVSII ADVDIYKFDP WDLPDKAVFG 60 EKEWYFFSPR DRKYPNGARP NRAAGSGYWK ATGTDKIIVA SSMAAGRGGV FSNIGVKKAL 120 VFYKGRPPKG IKTNWIMHEY RLSQNPNPNS NNRSFKSKDC SMRLDDW |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 3e-67 | 3 | 167 | 12 | 157 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 3e-67 | 3 | 167 | 12 | 157 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 3e-67 | 3 | 167 | 12 | 157 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 3e-67 | 3 | 167 | 12 | 157 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
| 3swm_B | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
| 3swm_C | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
| 3swm_D | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
| 3swp_A | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
| 3swp_B | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
| 3swp_C | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
| 3swp_D | 3e-67 | 3 | 167 | 15 | 160 | NAC domain-containing protein 19 |
| 4dul_A | 3e-67 | 3 | 167 | 12 | 157 | NAC domain-containing protein 19 |
| 4dul_B | 3e-67 | 3 | 167 | 12 | 157 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Gra.1281 | 0.0 | flower| flowering | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 48811276 | 0.0 | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012463494.1 | 1e-122 | PREDICTED: NAC domain-containing protein 18-like, partial | ||||
| Swissprot | Q84TD6 | 1e-81 | NAC47_ARATH; NAC transcription factor 47 | ||||
| TrEMBL | A0A2P5QWE5 | 1e-121 | A0A2P5QWE5_GOSBA; Uncharacterized protein | ||||
| STRING | Gorai.013G191800.1 | 1e-121 | (Gossypium raimondii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM190 | 28 | 276 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G04070.1 | 6e-82 | NAC domain containing protein 47 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Gorai.013G191800.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




