![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | HL.SW.v1.0.G000205.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 101aa MW: 10779 Da PI: 8.0662 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 104.7 | 5.8e-33 | 23 | 78 | 3 | 59 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
+vrY eC+kNhAas+Gg+avDGC+Efm+s geegt+aal+CaACgCHRnFHRreve
HL.SW.v1.0.G000205.1 23 SVRYGECQKNHAASVGGYAVDGCREFMAS-GEEGTTAALTCAACGCHRNFHRREVEA 78
79**************************9.999*********************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 4.0E-17 | 1 | 89 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 1.5E-31 | 24 | 76 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 6.4E-28 | 25 | 76 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 26.469 | 26 | 75 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MRKRQVVVRR EEISRSMAAA VRSVRYGECQ KNHAASVGGY AVDGCREFMA SGEEGTTAAL 60 TCAACGCHRN FHRREVEASS TNHHEVVCDS CSSPSSSNGV * |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022740047.1 | 8e-48 | mini zinc finger protein 2-like | ||||
| Swissprot | Q9LJW5 | 1e-38 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
| TrEMBL | A0A061EEU8 | 2e-43 | A0A061EEU8_THECC; Mini zinc finger 2 isoform 1 | ||||
| TrEMBL | A0A061EGD2 | 2e-43 | A0A061EGD2_THECC; Mini zinc finger 2 isoform 2 (Fragment) | ||||
| TrEMBL | B9T6Z4 | 9e-44 | B9T6Z4_RICCO; Transcription factor, putative | ||||
| STRING | EOY03457 | 4e-44 | (Theobroma cacao) | ||||
| STRING | XP_002534013.1 | 2e-44 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1550 | 34 | 100 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 2e-24 | mini zinc finger 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




