![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | HL.SW.v1.0.G011145.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 149aa MW: 17172.5 Da PI: 9.8613 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 157.5 | 5.7e-49 | 18 | 144 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88
+ pGfrF+Ptdeel+++yLkkk+eg++ ++ evi+ev+i k+ePwdLp k+v +++ew+fFs+r +ky++g++++rat+ gyWkatgk
HL.SW.v1.0.G011145.1 18 MFPGFRFSPTDEELISFYLKKKMEGSEKSI-EVITEVEIWKYEPWDLPaKSVIPSNSEWFFFSPRGRKYPNGSQSRRATELGYWKATGK 105
579************************999.99***************555556888******************************** PP
NAM 89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
+++v+s +++ +g+k+tLvf+ grap+ge+t+W+mhey +
HL.SW.v1.0.G011145.1 106 ERNVKS-GSTFIGTKRTLVFHIGRAPRGERTEWIMHEYCM 144
******.999****************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.96E-52 | 11 | 148 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 50.366 | 18 | 149 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.5E-26 | 20 | 143 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009845 | Biological Process | seed germination | ||||
| GO:0009938 | Biological Process | negative regulation of gibberellic acid mediated signaling pathway | ||||
| GO:0033619 | Biological Process | membrane protein proteolysis | ||||
| GO:0048573 | Biological Process | photoperiodism, flowering | ||||
| GO:0071472 | Biological Process | cellular response to salt stress | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005886 | Cellular Component | plasma membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 149 aa Download sequence Send to blast |
MVGTSSREAQ LSIAASSMFP GFRFSPTDEE LISFYLKKKM EGSEKSIEVI TEVEIWKYEP 60 WDLPAKSVIP SNSEWFFFSP RGRKYPNGSQ SRRATELGYW KATGKERNVK SGSTFIGTKR 120 TLVFHIGRAP RGERTEWIMH EYCMLDKSQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 1e-44 | 17 | 149 | 16 | 147 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-44 | 17 | 149 | 16 | 147 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-44 | 17 | 149 | 16 | 147 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-44 | 17 | 149 | 16 | 147 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 1e-44 | 17 | 149 | 19 | 150 | NAC domain-containing protein 19 |
| 3swm_B | 1e-44 | 17 | 149 | 19 | 150 | NAC domain-containing protein 19 |
| 3swm_C | 1e-44 | 17 | 149 | 19 | 150 | NAC domain-containing protein 19 |
| 3swm_D | 1e-44 | 17 | 149 | 19 | 150 | NAC domain-containing protein 19 |
| 3swp_A | 1e-44 | 17 | 149 | 19 | 150 | NAC domain-containing protein 19 |
| 3swp_B | 1e-44 | 17 | 149 | 19 | 150 | NAC domain-containing protein 19 |
| 3swp_C | 1e-44 | 17 | 149 | 19 | 150 | NAC domain-containing protein 19 |
| 3swp_D | 1e-44 | 17 | 149 | 19 | 150 | NAC domain-containing protein 19 |
| 4dul_A | 1e-44 | 17 | 149 | 16 | 147 | NAC domain-containing protein 19 |
| 4dul_B | 1e-44 | 17 | 149 | 16 | 147 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00280 | DAP | Transfer from AT2G27300 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024025054.1 | 2e-92 | NAC domain-containing protein 60 | ||||
| Swissprot | Q9XIN7 | 4e-76 | NAC40_ARATH; NAC domain-containing protein 40 | ||||
| TrEMBL | A0A2P5DZX9 | 4e-99 | A0A2P5DZX9_PARAD; NAC domain containing protein | ||||
| STRING | XP_010102025.1 | 5e-91 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF7315 | 33 | 46 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G27300.1 | 2e-78 | NTM1-like 8 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




