 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | HL.SW.v1.0.G014432.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 68aa MW: 7693.08 Da PI: 11.1949 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 92.6 | 1.9e-29 | 9 | 58 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtf+kRrng+ KKA+ELSvLCd+eva+iifs +gkl+e++s
HL.SW.v1.0.G014432.1 9 KRIENKINRQVTFAKRRNGL-KKAYELSVLCDVEVALIIFSARGKLHEFCS 58
79*****************5.****************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 28.889 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.4E-36 | 1 | 59 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 6.74E-35 | 2 | 58 | No hit | No description |
| SuperFamily | SSF55455 | 2.88E-27 | 2 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.2E-21 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.2E-24 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.2E-21 | 37 | 58 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 68 aa Download sequence Send to blast |
MGRGKVELKR IENKINRQVT FAKRRNGLKK AYELSVLCDV EVALIIFSAR GKLHEFCSGT 60 RLSTQRK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 6e-18 | 1 | 58 | 1 | 59 | MEF2C |
| 5f28_B | 6e-18 | 1 | 58 | 1 | 59 | MEF2C |
| 5f28_C | 6e-18 | 1 | 58 | 1 | 59 | MEF2C |
| 5f28_D | 6e-18 | 1 | 58 | 1 | 59 | MEF2C |
| 6byy_A | 5e-18 | 1 | 58 | 1 | 59 | MEF2 CHIMERA |
| 6byy_B | 5e-18 | 1 | 58 | 1 | 59 | MEF2 CHIMERA |
| 6byy_C | 5e-18 | 1 | 58 | 1 | 59 | MEF2 CHIMERA |
| 6byy_D | 5e-18 | 1 | 58 | 1 | 59 | MEF2 CHIMERA |
| 6bz1_A | 5e-18 | 1 | 58 | 1 | 59 | MEF2 CHIMERA |
| 6bz1_B | 5e-18 | 1 | 58 | 1 | 59 | MEF2 CHIMERA |
| 6bz1_C | 5e-18 | 1 | 58 | 1 | 59 | MEF2 CHIMERA |
| 6bz1_D | 5e-18 | 1 | 58 | 1 | 59 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. | |||||
| UniProt | Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:9339904, ECO:0000269|Ref.9}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007153483.1 | 9e-34 | hypothetical protein PHAVU_003G039400g | ||||
| Swissprot | Q8LLR2 | 2e-31 | MADS2_VITVI; Agamous-like MADS-box protein MADS2 | ||||
| Swissprot | Q9SAR1 | 2e-31 | MADS8_ORYSJ; MADS-box transcription factor 8 | ||||
| TrEMBL | V7C5L0 | 2e-32 | V7C5L0_PHAVU; Uncharacterized protein | ||||
| STRING | XP_007153483.1 | 3e-33 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G03710.3 | 2e-33 | MIKC_MADS family protein | ||||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|