![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | HL.SW.v1.0.G020862.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 66aa MW: 7525.7 Da PI: 10.1524 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 103.5 | 7.2e-33 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey++
HL.SW.v1.0.G020862.1 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN 59
79***********************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 34.104 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.5E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.78E-40 | 2 | 61 | No hit | No description |
| SuperFamily | SSF55455 | 3.66E-31 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.5E-34 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.5E-28 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.5E-34 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.5E-34 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYANQ 60 SYVHS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 3e-22 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 3e-22 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 3e-22 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 3e-22 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 3e-22 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 3e-22 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 3e-22 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 3e-22 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 3e-22 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 3e-22 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269|PubMed:11828031, ECO:0000269|PubMed:16326928, ECO:0000269|PubMed:9869408}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011016424.1 | 8e-37 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 | ||||
| Refseq | XP_021846001.1 | 1e-36 | floral homeotic protein AGAMOUS isoform X2 | ||||
| Swissprot | Q40704 | 2e-37 | MADS3_ORYSJ; MADS-box transcription factor 3 | ||||
| TrEMBL | A0A426XLP8 | 2e-36 | A0A426XLP8_ENSVE; Uncharacterized protein | ||||
| STRING | OS01T0201700-01 | 5e-37 | (Oryza sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58780.3 | 2e-38 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




