PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

HL.SW.v1.0.G031884.1

Organism

Humulus lupulus

Taxonomic ID

3486

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus

Family

M-type_MADS

Protein Properties

Length: 64aa MW: 7151.36 Da PI: 10.6236

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
HL.SW.v1.0.G031884.1	genome	HOPBASE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	90.2	1.1e-28	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k ienk rqvtf+kRr g++KKA+ELSvLCd+e+ +i+fs +g+lye+ss HL.SW.v1.0.G031884.1 9 KLIENKQSRQVTFAKRRSGLMKKAYELSVLCDVEIGLIVFSGNGRLYEFSS 59 579**********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	30.193	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	4.6E-36	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.96E-28	2	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	6.90E-33	2	59	No hit	No description
PRINTS	PR00404	1.4E-28	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.2E-27	11	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-28	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-28	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 64 aa Download sequence Send to blast
MGRAKVEMKL IENKQSRQVT FAKRRSGLMK KAYELSVLCD VEIGLIVFSG NGRLYEFSSG 60 HSR*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	6e-20	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_Q	6e-20	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_R	6e-20	1	59	1	59	Myocyte-specific enhancer factor 2B
1tqe_S	6e-20	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_A	6e-20	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_B	6e-20	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_C	6e-20	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_D	6e-20	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_E	6e-20	1	59	1	59	Myocyte-specific enhancer factor 2B
6c9l_F	6e-20	1	59	1	59	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269\|PubMed:9339904, ECO:0000269\|Ref.9}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022776351.1	2e-27	agamous-like MADS-box protein AGL70
Refseq	XP_028552867.1	2e-27	developmental protein SEPALLATA 3-like
Swissprot	Q9SAR1	5e-26	MADS8_ORYSJ; MADS-box transcription factor 8
TrEMBL	A0A2P5ARC8	3e-26	A0A2P5ARC8_PARAD; MADS-box transcription factor
TrEMBL	A0A2P5FQG1	2e-27	A0A2P5FQG1_TREOI; MADS-box transcription factor (Fragment)
STRING	Traes_4BS_59C6DEC88.2	1e-26	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.3	2e-28	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Jang YH, et al. Survey of rice proteins interacting with OsFCA and OsFY proteins which are homologous to the Arabidopsis flowering time proteins, FCA and FY. Plant Cell Physiol., 2009. 50(8): p. 1479-92 [PMID:19561057] Cui R, et al. Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa). Plant J., 2010. 61(5): p. 767-81 [PMID:20003164] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119]