PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc000071.1_g00046.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

YABBY

Protein Properties

Length: 238aa MW: 26460.3 Da PI: 7.8503

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc000071.1_g00046.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	28.7	4.1e-09	20	53	3	35
YABBY 3 vfssseqvCyvqCnfCntilavs.vPstslfkvv 35 + s eq+Cyv+CnfC+t+la+ Ps++lf ++ Itr_sc000071.1_g00046.1 20 LSPSGEQLCYVHCNFCDTVLAICtHPSNTLFLIL 53 567889**************98625999998775 PP
2	YABBY	188.9	2.5e-58	60	202	24	170
YABBY 24 vsvPstslfkvvtvrCGhCtsllsvnlakas.qllaaeshldeslkee..lleelkveeenlksnvekeesastsvsseklsened 106 vsvP +slfk+vtvrCGhCt+llsvn++ + + + hl +s+ + ll+e +++ +l +n+ + +++ ++ Itr_sc000071.1_g00046.1 60 VSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLlPTAPNQLHLPHSFFSPqnLLDEIRNTPPSLLMNQPNPNESL-------MPIRGI 138 9***********************99877245667778888887653466777766666666554444332.......345667 PP YABBY 107 eevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 +e+p++p ++rPPekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+ihfgl Itr_sc000071.1_g00046.1 139 DELPKPPVANRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 202 899999******************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	4.6E-6	24	52	IPR006780	YABBY protein
Pfam	PF04690	3.8E-57	60	202	IPR006780	YABBY protein
SuperFamily	SSF47095	6.55E-8	145	195	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	2.2E-4	151	194	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009909	Biological Process	regulation of flower development
GO:0009933	Biological Process	meristem structural organization
GO:0009944	Biological Process	polarity specification of adaxial/abaxial axis
GO:0010093	Biological Process	specification of floral organ identity
GO:0010154	Biological Process	fruit development
GO:0010158	Biological Process	abaxial cell fate specification
GO:0010159	Biological Process	specification of organ position
GO:0010450	Biological Process	inflorescence meristem growth
GO:1902183	Biological Process	regulation of shoot apical meristem development
GO:2000024	Biological Process	regulation of leaf development

Sequence ? help Back to Top
Protein Sequence Length: 238 aa Download sequence Send to blast
MSSSSTAFAP DHHHNHPHHL SPSGEQLCYV HCNFCDTVLA ICTHPSNTLF LILLIIAKDV 60 SVPCSSLFKT VTVRCGHCTN LLSVNMRGLL LPTAPNQLHL PHSFFSPQNL LDEIRNTPPS 120 LLMNQPNPNE SLMPIRGIDE LPKPPVANRP PEKRQRVPSA YNRFIKDEIQ RIKAGNPDIS 180 HREAFSAAAK NWAHFPHIHF GLMPDQPVKK PNACQQEGED GLMKDGFLAQ PNLGVSPY

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269\|PubMed:10323860, ECO:0000269\|PubMed:10331982, ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:11812777, ECO:0000269\|PubMed:12417699, ECO:0000269\|PubMed:19837869, ECO:0000269\|PubMed:9878633, ECO:0000269\|Ref.3, ECO:0000269\|Ref.6}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00620	PBM	Transfer from AT2G45190	Download

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ633045	0.0	AJ633045.1 Ipomoea nil partial mRNA for putative CRC transcription factor 1 (crc1 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019159560.1	1e-148	PREDICTED: axial regulator YABBY 1
Swissprot	O22152	2e-83	YAB1_ARATH; Axial regulator YABBY 1
TrEMBL	A0A2G9G6A7	1e-135	A0A2G9G6A7_9LAMI; Uncharacterized protein
STRING	XP_009793076.1	1e-131	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA381	24	163

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45190.1	1e-84	YABBY family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Lian H,Li X,Liu Z,He Y HYL1 is required for establishment of stamen architecture with four microsporangia in Arabidopsis. J. Exp. Bot., 2013. 64(11): p. 3397-410 [PMID:23918970] Tameshige T, et al. Pattern dynamics in adaxial-abaxial specific gene expression are modulated by a plastid retrograde signal during Arabidopsis thaliana leaf development. PLoS Genet., 2013. 9(7): p. e1003655 [PMID:23935517] Boter M, et al. FILAMENTOUS FLOWER Is a Direct Target of JAZ3 and Modulates Responses to Jasmonate. Plant Cell, 2015. 27(11): p. 3160-74 [PMID:26530088] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Tanaka W,Toriba T,Hirano HY Three TOB1-related YABBY genes are required to maintain proper function of the spikelet and branch meristems in rice. New Phytol., 2017. 215(2): p. 825-839 [PMID:28556940] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187]