PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc000188.1_g00017.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

M-type_MADS

Protein Properties

Length: 61aa MW: 7095.23 Da PI: 10.4603

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc000188.1_g00017.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	102.2	1.9e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+i+fss+g++yeys+ Itr_sc000188.1_g00017.1 9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRVYEYSN 59 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.754	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	6.0E-42	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.35E-30	2	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.08E-37	2	60	No hit	No description
PRINTS	PR00404	1.6E-33	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	9.9E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-33	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCD AEIALIVFSS RGRVYEYSNN 60 K

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_R	1e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
1tqe_S	1e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_A	1e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_B	1e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_C	1e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_D	1e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_E	1e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
6c9l_F	1e-21	1	60	1	60	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in seed development. {ECO:0000269\|PubMed:29853599}.
UniProt	Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269\|PubMed:21447172, ECO:0000269\|PubMed:29853599, ECO:0000269\|Ref.1}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019176798.1	4e-36	PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
Refseq	XP_019176799.1	4e-36	PREDICTED: agamous-like MADS-box protein AGL11 isoform X1
Refseq	XP_019176800.1	4e-36	PREDICTED: agamous-like MADS-box protein AGL11 isoform X2
Swissprot	A0A217EJJ0	4e-36	AG11S_VITVI; Agamous-like MADS-box protein AGL11
Swissprot	F6I457	4e-36	AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBL	A0A0V0IUC9	2e-35	A0A0V0IUC9_SOLCH; Putative ovule protein
STRING	Solyc11g028020.1.1	5e-35	(Solanum lycopersicum)
STRING	XP_009770275.1	7e-35	(Nicotiana sylvestris)
STRING	XP_009599024.1	7e-35	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.2	2e-37	MIKC_MADS family protein

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Mejía N, et al. Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine. BMC Plant Biol., 2011. 11: p. 57 [PMID:21447172] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Malabarba J, et al. The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine. J. Exp. Bot., 2017. 68(7): p. 1493-1506 [PMID:28369525] Royo C, et al. The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11. Plant Physiol., 2018. 177(3): p. 1234-1253 [PMID:29853599]