![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Itr_sc000350.1_g00009.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 98aa MW: 10698.9 Da PI: 4.0742 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 87.2 | 2.1e-27 | 19 | 83 | 2 | 66 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE-- CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvk 66
Fl k+y++++d+ ++e+++wsengnsfvv+++ efa+ +Lp+yFkh+nf+SF+RQLn+Yg +++
Itr_sc000350.1_g00009.1 19 FLIKTYDMVDDSGTDEIVQWSENGNSFVVWNPPEFARLLLPTYFKHNNFSSFIRQLNTYGQIMLT 83
9**********************************************************966655 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.6E-28 | 13 | 78 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 6.0E-29 | 15 | 96 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 2.0E-26 | 15 | 83 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 2.2E-17 | 19 | 42 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 8.6E-23 | 19 | 79 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.2E-17 | 57 | 69 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.2E-17 | 70 | 82 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 98 aa Download sequence Send to blast |
MDGLAPVQAG GGGGGPAPFL IKTYDMVDDS GTDEIVQWSE NGNSFVVWNP PEFARLLLPT 60 YFKHNNFSSF IRQLNTYGQI MLTATAGTRD DQISDINV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1hks_A | 7e-19 | 12 | 92 | 1 | 82 | HEAT-SHOCK TRANSCRIPTION FACTOR |
| 1hkt_A | 7e-19 | 12 | 92 | 1 | 82 | HEAT-SHOCK TRANSCRIPTION FACTOR |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269|PubMed:16202242}. | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010673379.1 | 3e-39 | PREDICTED: heat stress transcription factor A-5 | ||||
| Swissprot | Q7XHZ0 | 5e-30 | HFB4B_ORYSJ; Heat stress transcription factor B-4b | ||||
| Swissprot | Q94BZ5 | 6e-30 | HSFA5_ARATH; Heat stress transcription factor A-5 | ||||
| TrEMBL | A0A0J8CRZ7 | 8e-38 | A0A0J8CRZ7_BETVU; Uncharacterized protein | ||||
| STRING | XP_010673379.1 | 1e-38 | (Beta vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA572 | 24 | 113 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G13980.1 | 3e-32 | HSF family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




