PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc000389.1_g00005.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

ZF-HD

Protein Properties

Length: 88aa MW: 9470.67 Da PI: 8.776

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc000389.1_g00005.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	98.2	6.3e-31	28	82	3	58
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 vrY eC++N Aa++Ggh++DGC Efmps g egt+aal+CaACgCHR+FHR+ v+ Itr_sc000389.1_g00005.1 28 IVRYGECQRNYAATTGGHVLDGCLEFMPS-GGEGTPAALTCAACGCHRSFHRQVVV 82 589***********************9.8899****************9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	2.0E-16	29	81	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	1.8E-29	29	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.4E-25	30	79	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.167	31	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MKRSIRVDDR LDSTRRYTAG TTSRVTTIVR YGECQRNYAA TTGGHVLDGC LEFMPSGGEG 60 TPAALTCAAC GCHRSFHRQV VVSVATST

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProt	Putative transcription factor.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020224980.1	7e-25	mini zinc finger protein 3
Swissprot	Q0J5F8	9e-22	MIF4_ORYSJ; Mini zinc finger protein 4
Swissprot	Q9SVL0	1e-21	ZHD7_ARATH; Zinc-finger homeodomain protein 7
TrEMBL	A0A2R6P9H7	8e-24	A0A2R6P9H7_ACTCH; Mini zinc finger protein
STRING	Gorai.006G017300.1	8e-24	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G50890.1	6e-24	homeobox protein 28

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]