PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc000408.1_g00016.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

MYB

Protein Properties

Length: 183aa MW: 20873.4 Da PI: 9.076

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc000408.1_g00016.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	60.6	3.4e-19	15	62	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l ++++ +G + Wkt+a + g++R++k+c++rw++yl Itr_sc000408.1_g00016.1 15 KGAWTAEEDKKLTQYIENHGAKKWKTVAIKSGLNRCGKSCRLRWLNYL 62 79********************************************97 PP
2	Myb_DNA-binding	46.9	6.6e-15	69	113	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g+ ++E +l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Itr_sc000408.1_g00016.1 69 GNIAEDEADLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 113 566689*************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	24.637	10	66	IPR017930	Myb domain
SuperFamily	SSF46689	2.85E-29	12	109	IPR009057	Homeodomain-like
SMART	SM00717	2.2E-14	14	64	IPR001005	SANT/Myb domain
Pfam	PF00249	8.4E-17	15	62	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.5E-23	16	69	IPR009057	Homeodomain-like
CDD	cd00167	1.23E-10	17	62	No hit	No description
SMART	SM00717	9.3E-14	67	115	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	19.844	67	117	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	7.7E-24	70	117	IPR009057	Homeodomain-like
Pfam	PF00249	3.4E-13	71	113	IPR001005	SANT/Myb domain
CDD	cd00167	4.83E-10	73	113	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009957	Biological Process	epidermal cell fate specification
GO:0010090	Biological Process	trichome morphogenesis
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048481	Biological Process	plant ovule development
GO:0048629	Biological Process	trichome patterning
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 183 aa Download sequence Send to blast
MSSRKSGGAR MHVHKGAWTA EEDKKLTQYI ENHGAKKWKT VAIKSGLNRC GKSCRLRWLN 60 YLRPNIKRGN IAEDEADLIL RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN THLSKKVTQV 120 GKSSLSATQN QPPKANAEQV GGNKESEEEE DPELNFDVDE FFDFSVEGTY GTEWVNKFLE 180 VEN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-28	15	117	7	108	B-MYB
1h8a_C	4e-28	13	117	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019173502.1	1e-124	PREDICTED: transcription factor MYB114-like isoform X2
Swissprot	P10290	3e-51	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	A0A1Q3BY67	6e-86	A0A1Q3BY67_CEPFO; Myb_DNA-binding domain-containing protein
STRING	EOY24284	5e-82	(Theobroma cacao)
STRING	cassava4.1_024299m	5e-82	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09460.1	2e-53	myb domain protein 6

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]