PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc000482.1_g00008.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

MYB_related

Protein Properties

Length: 73aa MW: 8184.31 Da PI: 5.6347

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc000482.1_g00008.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	36	1.6e-11	14	43	1	30
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 +g+WT+eEd +lv +++++G+g+W++++ Itr_sc000482.1_g00008.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTN 43 79************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.3E-13	5	47	IPR009057	Homeodomain-like
SuperFamily	SSF46689	3.59E-10	8	43	IPR009057	Homeodomain-like
PROSITE profile	PS51294	10.1	9	53	IPR017930	Myb domain
Pfam	PF00249	7.7E-10	14	43	IPR001005	SANT/Myb domain
CDD	cd00167	1.01E-6	16	40	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 73 aa Download sequence Send to blast
MGRPPCCDKI GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTEARELT QGKSSLVGIE 60 SYLPLELPHW VNN

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269\|PubMed:22018045}.
UniProt	Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light) (PubMed:16005291, PubMed:21637967). Promotes guard cell deflation in response to water deficit. Triggers root growth upon osmotic stress (e.g. mannitol containing medium) (PubMed:21637967). {ECO:0000269\|PubMed:16005291, ECO:0000269\|PubMed:21637967}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by jasmonic acid (JA) and salicylic acid (SA) (PubMed:16463103). Triggered by auxin (IAA) in roots (PubMed:9839469, PubMed:21637967). Stimulated by light, UV-light and cold (PubMed:9839469). According to PubMed:16005291 and PubMed:23828545, rapidly repressed by abscisic acid (ABA) in an ABI1-dependent manner. But in contrast, according to PubMed:21637967, transiently induced by ABA in seedlings (PubMed:16005291, PubMed:21637967, PubMed:23828545). Rapidly repressed by drought. Activated by white light, but repressed by blue light and darkness (PubMed:16005291). Transiently induced by salt (NaCl) in seedlings. Induced by sucrose (PubMed:21637967). Positively regulated by SCAP1 (PubMed:23453954). {ECO:0000269\|PubMed:16005291, ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:21637967, ECO:0000269\|PubMed:23453954, ECO:0000269\|PubMed:23828545, ECO:0000269\|PubMed:9839469}.
UniProt	INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269\|PubMed:22018045}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017621802.1	4e-26	PREDICTED: myb-related protein 306-like isoform X1
Swissprot	B3VTV7	4e-26	MYB60_VITVI; Transcription factor MYB60
Swissprot	Q8GYP5	2e-26	MYB60_ARATH; Transcription factor MYB60
TrEMBL	A0A0A0LQ55	5e-25	A0A0A0LQ55_CUCSA; Uncharacterized protein
STRING	XP_006482590.1	2e-25	(Citrus sinensis)
STRING	fgenesh1_pg.C_scaffold_1003053	1e-25	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G08810.1	7e-29	myb domain protein 60

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Galbiati M, et al. Gene trap lines identify Arabidopsis genes expressed in stomatal guard cells. Plant J., 2008. 53(5): p. 750-62 [PMID:18036199] Rusconi F, et al. The Arabidopsis thaliana MYB60 promoter provides a tool for the spatio-temporal control of gene expression in stomatal guard cells. J. Exp. Bot., 2013. 64(11): p. 3361-71 [PMID:23828545] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kim D,Ntui VO,Xiong L Arabidopsis YAK1 regulates abscisic acid response and drought resistance. FEBS Lett., 2016. 590(14): p. 2201-9 [PMID:27264339]