PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc000559.1_g00009.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

NF-YB

Protein Properties

Length: 115aa MW: 13213.9 Da PI: 5.2992

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc000559.1_g00009.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	152.3	9.1e-48	4	96	3	95
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 e++++lPianv+rimk++lP++akisk+ake +qe +sefisfvt+easdkc++e+rkt+ngdd++wal++lG+++y+e+++ yl+k+ Itr_sc000559.1_g00009.1 4 EHEKLLPIANVGRIMKQILPEKAKISKEAKERMQESASEFISFVTCEASDKCHKENRKTVNGDDIVWALSSLGLDNYAEAMTRYLHKF 91 7899********************************************************************************** PP NF-YB 91 releg 95 re e Itr_sc000559.1_g00009.1 92 REYEM 96 985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	2.9E-44	4	110	IPR009072	Histone-fold
SuperFamily	SSF47113	4.66E-35	6	106	IPR009072	Histone-fold
Pfam	PF00808	5.7E-25	9	72	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.7E-17	36	54	No hit	No description
PRINTS	PR00615	1.7E-17	55	73	No hit	No description
PRINTS	PR00615	1.7E-17	74	92	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 115 aa Download sequence Send to blast
MGDEHEKLLP IANVGRIMKQ ILPEKAKISK EAKERMQESA SEFISFVTCE ASDKCHKENR 60 KTVNGDDIVW ALSSLGLDNY AEAMTRYLHK FREYEMLRAS QTRGPAGEED ETDRY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	8e-39	4	93	3	92	Transcription factor HapC (Eurofung)
4g92_B	8e-39	4	93	3	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00133	DAP	Transfer from AT1G09030	Download

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019186652.1	7e-75	PREDICTED: nuclear transcription factor Y subunit B-4-like
Swissprot	O04027	6e-52	NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBL	A0A2G9IB64	1e-54	A0A2G9IB64_9LAMI; Uncharacterized protein
STRING	XP_009760265.1	1e-54	(Nicotiana sylvestris)
STRING	XP_009605488.1	1e-54	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09030.1	2e-54	nuclear factor Y, subunit B4

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]