![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Itr_sc000727.1_g00002.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 94aa MW: 10012 Da PI: 7.8868 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 106.9 | 1.2e-33 | 26 | 83 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
++rY eC+kNhAas+Gg+avDGC+Efmps +e + aaal+CaACgCHRnFHRreve+e
Itr_sc000727.1_g00002.1 26 SIRYGECQKNHAASVGGYAVDGCREFMPSGEEGSGAAALTCAACGCHRNFHRREVETE 83
689**************************555589*******************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 2.0E-16 | 27 | 90 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 3.9E-30 | 27 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 2.5E-27 | 28 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 26.434 | 29 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 94 aa Download sequence Send to blast |
MKRHKVVVKR EQSSQSSANS SFAVSSIRYG ECQKNHAASV GGYAVDGCRE FMPSGEEGSG 60 AAALTCAACG CHRNFHRREV ETEVLNDVSS SNAS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022740047.1 | 8e-43 | mini zinc finger protein 2-like | ||||
| Swissprot | Q9LJW5 | 3e-33 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
| TrEMBL | A0A438HDX6 | 8e-41 | A0A438HDX6_VITVI; Mini zinc finger protein 2 | ||||
| STRING | EOY03457 | 3e-41 | (Theobroma cacao) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA1105 | 24 | 86 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 1e-23 | mini zinc finger 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




