PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001111.1_g00001.1
Organism
Ipomoea trifida
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family M-type_MADS
Protein Properties Length: 80aa    MW: 9250.98 Da    PI: 11.1381
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001111.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.54.2e-29959151
                             S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                   SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                             krien + rqv+fskRr g+lKKA+ELSvLCd e+ +i+fs+tgklye+ss
  Itr_sc001111.1_g00001.1  9 KRIENATSRQVSFSKRRRGLLKKAFELSVLCDSEITLIVFSPTGKLYEFSS 59
                             79***********************************************96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.1E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.628161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.93E-28363IPR002100Transcription factor, MADS-box
CDDcd002654.44E-34361No hitNo description
PRINTSPR004042.6E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MVRGKTELKR IENATSRQVS FSKRRRGLLK KAFELSVLCD SEITLIVFSP TGKLYEFSSS  60
SRNFKIPVFF LSLQMMIIFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-17161161MEF2C
5f28_B3e-17161161MEF2C
5f28_C3e-17161161MEF2C
5f28_D3e-17161161MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:24121311}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019156247.13e-34PREDICTED: MADS-box protein SOC1-like
RefseqXP_019156248.13e-34PREDICTED: MADS-box protein SOC1-like
RefseqXP_019156249.13e-34PREDICTED: MADS-box protein SOC1-like
SwissprotQ388381e-31AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBLA0A1S3YX417e-31A0A1S3YX41_TOBAC; agamous-like MADS-box protein AGL19
TrEMBLK4AHE26e-31K4AHE2_SETIT; Uncharacterized protein
TrEMBLM4EKV76e-31M4EKV7_BRARP; Uncharacterized protein
STRINGXP_009607136.17e-32(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.14e-34AGAMOUS-like 14
Publications ? help Back to Top
  1. Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W
    GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox.
    Plant Physiol., 2004. 136(1): p. 2621-32
    [PMID:15375207]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Qu Y, et al.
    Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis.
    J. Exp. Bot., 2017. 68(17): p. 4851-4867
    [PMID:28992128]