PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc001225.1_g00005.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

HSF

Protein Properties

Length: 103aa MW: 11244.7 Da PI: 4.8679

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc001225.1_g00005.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	86.7	3e-27	38	97	2	61
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 Fl k+y++++d+++++++sws ++nsfvv+d+ efak++LpkyFkh+nf+SFvRQLn+Y Itr_sc001225.1_g00005.1 38 FLVKTYDMVDDPSTDKIVSWSPTNNSFVVWDPPEFAKDLLPKYFKHNNFSSFVRQLNTYI 97 9******************999*********************************6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	1.9E-30	29	98	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	2.3E-25	34	98	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	5.17E-26	36	97	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	1.2E-17	38	61	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	2.5E-23	38	97	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.2E-17	76	88	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.2E-17	89	101	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 103 aa Download sequence Send to blast
MELNSSSGGK GAAAGDGAQP SLPPQPAPMP STNSPPPFLV KTYDMVDDPS TDKIVSWSPT 60 NNSFVVWDPP EFAKDLLPKY FKHNNFSSFV RQLNTYIYPI LGL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	1e-22	22	98	14	89	Heat shock factor protein 1
5d5v_B	1e-22	22	98	14	89	Heat shock factor protein 1
5d5v_D	1e-22	22	98	14	89	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019182005.1	9e-62	PREDICTED: heat shock factor protein HSF8-like
Refseq	XP_019182006.1	9e-62	PREDICTED: heat shock factor protein HSF8-like
Swissprot	Q40152	2e-37	HSF8_SOLLC; Heat shock factor protein HSF8
TrEMBL	A0A314L0P4	2e-42	A0A314L0P4_NICAT; Heat shock factor protein hsf8
STRING	XP_009781208.1	7e-43	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA572	24	113

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G17750.1	5e-34	heat shock factor 1

Publications ? help Back to Top
Zhu B, et al. Identification and characterization of a novel heat shock transcription factor gene, GmHsfA1, in soybeans (Glycine max). J. Plant Res., 2006. 119(3): p. 247-56 [PMID:16570125] Cai SY, et al. HsfA1a upregulates melatonin biosynthesis to confer cadmium tolerance in tomato plants. J. Pineal Res., 2017. [PMID:28095626] Zhou J, et al. Heat Shock Factor HsfA1a Is Essential for R Gene-Mediated Nematode Resistance and Triggers H2O2 Production1. Plant Physiol., 2018. 176(3): p. 2456-2471 [PMID:29339397]