PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc003127.1_g00001.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

WOX

Protein Properties

Length: 55aa MW: 6503.61 Da PI: 11.1733

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc003127.1_g00001.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	21.7	3.4e-07	2	36	5	38
SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHCT CS Homeobox 5 ttftkeqleeLeelFek.nrypsaeereeLAkklg 38 +++++eq+++Le+lF++ +ps e++++ kl+ Itr_sc003127.1_g00001.1 2 WNPKPEQIRILESLFNSgVVNPSWEKIRRVRIKLE 36 99************99********9988875 PP
2	Wus_type_Homeobox	57	4.7e-19	2	41	6	45
Wus_type_Homeobox 6 WtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGki 45 W+P+peQi+iLe+l++sG+++P+ e+i+r++ +LeeyGk+ Itr_sc003127.1_g00001.1 2 WNPKPEQIRILESLFNSGVVNPSWEKIRRVRIKLEEYGKV 41 ***************************************9 PP

Sequence ? help Back to Top
Protein Sequence Length: 55 aa Download sequence Send to blast
MWNPKPEQIR ILESLFNSGV VNPSWEKIRR VRIKLEEYGK VVMPMSFTGS RTRNP

Functional Description ? help Back to Top
Source	Description
UniProt	Homeodomain transcription factor required for meristem growth and early development (PubMed:15753038). Promotes cell proliferation and prevents premature differentiation in meristematic tissues during postembryonic development (PubMed:15753038). Essential for maintaining tissue growth during embryogenesis (PubMed:17706632). May act by repressing TSS to promote meristematic proliferation (PubMed:21185286). Involved in the transcriptional activation of a subset of cytokinin response factors (PubMed:20110319). May act as a negative regulator of cytokinin signaling in the dark (PubMed:21057190). {ECO:0000269\|PubMed:15753038, ECO:0000269\|PubMed:17706632, ECO:0000269\|PubMed:20110319, ECO:0000269\|PubMed:21057190, ECO:0000303\|PubMed:21185286}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2. {ECO:0000269\|PubMed:21316593}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010481511.1	5e-14	PREDICTED: WUSCHEL-related homeobox 8-like
Refseq	XP_010494755.1	5e-14	PREDICTED: WUSCHEL-related homeobox 8-like
Refseq	XP_023640913.1	5e-14	WUSCHEL-related homeobox 8
Swissprot	Q6X7J4	1e-14	WOX9_ARATH; WUSCHEL-related homeobox 9

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA6166	22	31

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33880.1	6e-17	homeobox-3

Publications ? help Back to Top
Wang W, et al. Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice. PLoS Genet., 2014. 10(3): p. e1004154 [PMID:24625559] Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S Wuschel-related homeobox 8/9 is important for proper embryo patterning in the gymnosperm Norway spruce. J. Exp. Bot., 2014. 65(22): p. 6543-52 [PMID:25205582] Raines T, et al. The cytokinin response factors modulate root and shoot growth and promote leaf senescence in Arabidopsis. Plant J., 2016. 85(1): p. 134-47 [PMID:26662515] Dolzblasz A, et al. Stem Cell Regulation by Arabidopsis WOX Genes. Mol Plant, 2016. 9(7): p. 1028-39 [PMID:27109605] Blein T,Pautot V,Laufs P Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection. Plants (Basel), 2013. 2(2): p. 230-47 [PMID:27137374]