![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Itr_sc005771.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 84aa MW: 8505.56 Da PI: 4.078 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 25 | 4.9e-08 | 52 | 83 | 2 | 33 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-H CS
HSF_DNA-bind 2 Flkklyeiledeelkeliswsengnsfvvlde 33
Fl+k++ +++d++++ +i w ++++sfvv+d+
Itr_sc005771.1_g00001.1 52 FLSKTFAMVDDPNTDAIIAWGASKKSFVVWDP 83
9********************999******96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 2.3E-9 | 47 | 83 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 2.58E-7 | 48 | 83 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 7.8E-6 | 52 | 84 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MVAESLGIDG GGGGVTVKVE AEVVVVDECD DGGNGGLRSM EGVKGVGGPA PFLSKTFAMV 60 DDPNTDAIIA WGASKKSFVV WDPH |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator expressed upon environmental stress that specifically binds DNA of heat shock promoter elements (HSE). Involved in heat stress response. {ECO:0000269|PubMed:18064488}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:18064488}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019192499.1 | 6e-25 | PREDICTED: heat shock factor protein HSF30-like isoform X1 | ||||
| Refseq | XP_019192500.1 | 6e-25 | PREDICTED: heat stress transcription factor A-2-like isoform X2 | ||||
| Swissprot | Q6F388 | 3e-15 | HFA2E_ORYSJ; Heat stress transcription factor A-2e | ||||
| TrEMBL | A0A1S4CRR3 | 4e-17 | A0A1S4CRR3_TOBAC; heat stress transcription factor A-7a-like | ||||
| STRING | XP_009606363.1 | 7e-18 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA572 | 24 | 113 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G63350.1 | 3e-15 | HSF family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




