![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Itr_sc006654.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 44aa MW: 4971.75 Da PI: 9.9277 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 30.9 | 6.5e-10 | 14 | 43 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30
+g+W+t Ed+ll ++++q+G g+W++ +++
Itr_sc006654.1_g00001.1 14 KGPWSTKEDLLLTNYIQQHGEGQWRSLPKK 43
79***********************99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.3E-12 | 5 | 43 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 2.47E-8 | 8 | 43 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 12.756 | 9 | 44 | IPR017930 | Myb domain |
| Pfam | PF00249 | 2.4E-7 | 14 | 43 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.51E-4 | 16 | 43 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 44 aa Download sequence Send to blast |
MGRAPCCSKE GLKKGPWSTK EDLLLTNYIQ QHGEGQWRSL PKKA |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019200152.1 | 4e-24 | PREDICTED: myb-related protein Myb4-like isoform X1 | ||||
| Refseq | XP_019200153.1 | 4e-24 | PREDICTED: myb-related protein Myb4-like isoform X2 | ||||
| Swissprot | Q9LDR8 | 2e-16 | MY102_ARATH; Transcription factor MYB102 | ||||
| TrEMBL | A0A328E3D0 | 1e-21 | A0A328E3D0_9ASTE; Uncharacterized protein | ||||
| STRING | Solyc08g082890.2.1 | 3e-21 | (Solanum lycopersicum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G21440.1 | 7e-19 | MYB-like 102 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




