![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Itr_sc010485.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 102aa MW: 11561.9 Da PI: 6.767 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 54.3 | 1.9e-17 | 9 | 42 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
Cs+C++t+Tp+WR+gp g tLCn+CG++y +
Itr_sc010485.1_g00001.1 9 CSHCKATETPQWRKGPMGLNTLCNPCGIRYSTGR 42
******************************8766 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 12.11 | 3 | 38 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 4.9E-14 | 3 | 57 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.38E-14 | 6 | 64 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 3.0E-15 | 7 | 40 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 3.55E-12 | 8 | 55 | No hit | No description |
| Pfam | PF00320 | 2.5E-14 | 9 | 40 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
EGSKEFRECS HCKATETPQW RKGPMGLNTL CNPCGIRYST GRLFPDYRPA NSPTFVPTLH 60 STSHRKVGEM RRNGVEEAAM VDEDSVKTDA EEEKKKMEEA KE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019197212.1 | 3e-47 | PREDICTED: GATA transcription factor 11-like | ||||
| Swissprot | Q9SV30 | 2e-30 | GATA8_ARATH; GATA transcription factor 8 | ||||
| TrEMBL | A0A068UF30 | 2e-32 | A0A068UF30_COFCA; Uncharacterized protein | ||||
| STRING | cassava4.1_026346m | 2e-32 | (Manihot esculenta) | ||||
| STRING | XP_009774660.1 | 5e-32 | (Nicotiana sylvestris) | ||||
| STRING | XP_009598796.1 | 3e-32 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA3134 | 21 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54810.2 | 2e-32 | GATA family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




