![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Itr_sc023973.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 52aa MW: 6034.81 Da PI: 7.7985 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 70.6 | 3.1e-22 | 1 | 52 | 9 | 60 |
HHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 9 iledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
+++d++++ +i w ++++sfvv+d+++fa+++Lp++Fkh nf+SFvRQLn+Y
Itr_sc023973.1_g00001.1 1 MVDDPNTDAIIAWGASKKSFVVWDPHRFATELLPQHFKHANFSSFVRQLNTY 52
89************999**********************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00447 | 8.3E-19 | 1 | 52 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 2.72E-19 | 1 | 52 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 2.0E-6 | 1 | 52 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene3D | G3DSA:1.10.10.10 | 2.5E-22 | 1 | 52 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 5.9E-6 | 32 | 44 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 5.9E-6 | 45 | 52 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 52 aa Download sequence Send to blast |
MVDDPNTDAI IAWGASKKSF VVWDPHRFAT ELLPQHFKHA NFSSFVRQLN TY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 9e-16 | 1 | 52 | 36 | 87 | Heat shock factor protein 1 |
| 5d5v_B | 9e-16 | 1 | 52 | 36 | 87 | Heat shock factor protein 1 |
| 5d5v_D | 9e-16 | 1 | 52 | 36 | 87 | Heat shock factor protein 1 |
| 5hdg_A | 9e-16 | 1 | 52 | 17 | 68 | Heat shock factor protein 1 |
| 5hdn_A | 9e-16 | 1 | 52 | 17 | 68 | Heat shock factor protein 1 |
| 5hdn_B | 9e-16 | 1 | 52 | 17 | 68 | Heat shock factor protein 1 |
| 5hdn_C | 9e-16 | 1 | 52 | 17 | 68 | Heat shock factor protein 1 |
| 5hdn_D | 9e-16 | 1 | 52 | 17 | 68 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019192499.1 | 3e-31 | PREDICTED: heat shock factor protein HSF30-like isoform X1 | ||||
| Refseq | XP_019192500.1 | 3e-31 | PREDICTED: heat stress transcription factor A-2-like isoform X2 | ||||
| Swissprot | Q5Z6A4 | 1e-22 | HFA6A_ORYSJ; Putative heat stress transcription factor A-6a | ||||
| TrEMBL | A0A453SCM3 | 4e-24 | A0A453SCM3_AEGTS; Uncharacterized protein | ||||
| STRING | Traes_2AS_66F050AC7.1 | 4e-24 | (Triticum aestivum) | ||||
| STRING | TRIUR3_19594-P1 | 6e-24 | (Triticum urartu) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA572 | 24 | 113 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G51910.1 | 3e-24 | heat shock transcription factor A7A | ||||




