PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Itr_sc032675.1_g00001.1

Organism

Ipomoea trifida

Taxonomic ID

35884

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea

Family

M-type_MADS

Protein Properties

Length: 50aa MW: 5556.78 Da PI: 10.9829

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Itr_sc032675.1_g00001.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	57.9	1.3e-18	10	50	2	42
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42 +i n+s r+ t+ kR++g++KK +ELS+LC+++++ ii+s+ Itr_sc032675.1_g00001.1 10 FITNDSARKATLKKRKKGLMKKVSELSTLCGIDACAIIYSP 50 89*************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF55455	1.83E-19	1	50	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	16.722	1	50	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.4E-15	1	50	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.2E-11	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.0E-18	10	50	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.2E-11	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.2E-11	38	50	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 50 aa Download sequence Send to blast
MTRKKVKLAF ITNDSARKAT LKKRKKGLMK KVSELSTLCG IDACAIIYSP

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	2	24	RKKVKLAFITNDSARKATLKKRK
2	21	25	KKRKK

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of gametophytes and seeds. {ECO:0000269\|PubMed:12815071}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by MEA, FIS2 and FIE in seeds, and by PKL after germination. {ECO:0000269\|PubMed:12815071, ECO:0000269\|PubMed:16359393}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009618313.1	1e-27	PREDICTED: agamous-like MADS-box protein AGL86
Swissprot	O80805	1e-16	PHE1_ARATH; MADS-box transcription factor PHERES 1
TrEMBL	A0A067JUW4	7e-25	A0A067JUW4_JATCU; Uncharacterized protein
STRING	XP_009618313.1	5e-27	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1532	23	67

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G48670.1	2e-14	AGAMOUS-like 80

Publications ? help Back to Top
Raissig MT,Bemer M,Baroux C,Grossniklaus U Genomic imprinting in the Arabidopsis embryo is partly regulated by PRC2. PLoS Genet., 2013. 9(12): p. e1003862 [PMID:24339783] Jeong CW, et al. Control of Paternally Expressed Imprinted UPWARD CURLY LEAF1, a Gene Encoding an F-Box Protein That Regulates CURLY LEAF Polycomb Protein, in the Arabidopsis Endosperm. PLoS ONE, 2015. 10(2): p. e0117431 [PMID:25689861] Burkart-Waco D,Ngo K,Lieberman M,Comai L Perturbation of parentally biased gene expression during interspecific hybridization. PLoS ONE, 2015. 10(2): p. e0117293 [PMID:25719202] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]