![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Itr_sc045158.1_g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 99aa MW: 11318.8 Da PI: 8.0969 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 50.5 | 2.8e-16 | 7 | 39 | 2 | 34 |
GATA 2 snCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
++C++t+Tp+WR+gp g tLCn+CG++y +
Itr_sc045158.1_g00001.1 7 RHCKATETPQWRKGPMGLNTLCNPCGIRYSTGR 39
69***************************8766 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 6.3E-8 | 4 | 54 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 3.1E-13 | 7 | 38 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.47E-12 | 8 | 63 | No hit | No description |
| CDD | cd00202 | 7.02E-12 | 8 | 52 | No hit | No description |
| PROSITE profile | PS50114 | 9.302 | 8 | 35 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 1.2E-12 | 8 | 37 | IPR013088 | Zinc finger, NHR/GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
MGFHHPRHCK ATETPQWRKG PMGLNTLCNP CGIRYSTGRL FPEYRPANSP TFVPTLHFSS 60 HRKVGEMRRK GVEEAAMVDE DSVKTDAEEE KKTMEEAKE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019197212.1 | 3e-40 | PREDICTED: GATA transcription factor 11-like | ||||
| Swissprot | Q9SV30 | 8e-29 | GATA8_ARATH; GATA transcription factor 8 | ||||
| TrEMBL | A0A068UF30 | 9e-31 | A0A068UF30_COFCA; Uncharacterized protein | ||||
| STRING | XP_006485699.1 | 2e-29 | (Citrus sinensis) | ||||
| STRING | XP_006436435.1 | 2e-29 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA3134 | 21 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54810.2 | 8e-31 | GATA family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




