![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Jcr4S00011.130 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 90aa MW: 10570.1 Da PI: 9.7768 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 53.8 | 6.6e-17 | 6 | 60 | 73 | 128 |
NAM 73 rknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
r+n+++ +g+Wkatg d ++ s + vg k+tLv+++ + ++++kt+W+mhey++
Jcr4S00011.130 6 RPNQKACNGFWKATGADVHIRS-NMLIVGYKTTLVYFEDNPKESTKTNWIMHEYKI 60
78898999*************9.9999***************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 24.422 | 1 | 88 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 1.57E-22 | 3 | 87 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.6E-8 | 8 | 60 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MSKWVRPNQK ACNGFWKATG ADVHIRSNML IVGYKTTLVY FEDNPKESTK TNWIMHEYKI 60 DKRSPSSANR TPGDMKLDNW VLCKVYNREE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 1e-18 | 6 | 89 | 88 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-18 | 6 | 89 | 88 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-18 | 6 | 89 | 88 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-18 | 6 | 89 | 88 | 166 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 1e-18 | 6 | 89 | 91 | 169 | NAC domain-containing protein 19 |
| 3swm_B | 1e-18 | 6 | 89 | 91 | 169 | NAC domain-containing protein 19 |
| 3swm_C | 1e-18 | 6 | 89 | 91 | 169 | NAC domain-containing protein 19 |
| 3swm_D | 1e-18 | 6 | 89 | 91 | 169 | NAC domain-containing protein 19 |
| 3swp_A | 1e-18 | 6 | 89 | 91 | 169 | NAC domain-containing protein 19 |
| 3swp_B | 1e-18 | 6 | 89 | 91 | 169 | NAC domain-containing protein 19 |
| 3swp_C | 1e-18 | 6 | 89 | 91 | 169 | NAC domain-containing protein 19 |
| 3swp_D | 1e-18 | 6 | 89 | 91 | 169 | NAC domain-containing protein 19 |
| 4dul_A | 1e-18 | 6 | 89 | 88 | 166 | NAC domain-containing protein 19 |
| 4dul_B | 1e-18 | 6 | 89 | 88 | 166 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015389322.1 | 5e-25 | NAC transcription factor 32-like | ||||
| TrEMBL | A0A067ES30 | 2e-23 | A0A067ES30_CITSI; Uncharacterized protein | ||||
| TrEMBL | A0A067F1I4 | 4e-24 | A0A067F1I4_CITSI; Uncharacterized protein (Fragment) | ||||
| TrEMBL | A0A2H5QXH1 | 6e-24 | A0A2H5QXH1_CITUN; Uncharacterized protein | ||||
| STRING | XP_006446143.1 | 2e-23 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF17306 | 5 | 7 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69490.1 | 3e-23 | NAC-like, activated by AP3/PI | ||||




