![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Jcr4S00133.10 | ||||||||
| Common Name | JCGZ_18739, LOC105641427 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 60aa MW: 6812.91 Da PI: 10.7484 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 92 | 2.9e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n++ rqvtfskRr g++KKA+ELS+LCdae+a+i+fs tgkl ey+s
Jcr4S00133.10 9 KKIDNNTARQVTFSKRRRGLFKKAYELSTLCDAEIALIVFSGTGKLSEYAS 59
78***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.562 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 4.4E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.83E-28 | 2 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 8.52E-34 | 3 | 60 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.2E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.4E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.2E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.2E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 60 aa Download sequence Send to blast |
MTRQKIQIKK IDNNTARQVT FSKRRRGLFK KAYELSTLCD AEIALIVFSG TGKLSEYASS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 3e-20 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_B | 3e-20 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_C | 3e-20 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_D | 3e-20 | 1 | 60 | 1 | 60 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU334633 | 5e-47 | EU334633.1 Euphorbia esula dormancy associated MADS-box protein (DAM1) gene, complete cds. | |||
| GenBank | EU339320 | 5e-47 | EU339320.1 Euphorbia esula dormancy associated MADS-box 2 (DAM2) mRNA, complete cds. | |||
| GenBank | JX966351 | 5e-47 | JX966351.1 Euphorbia esula clone BAC_DAM3 DAM3 (DAM3) gene, complete cds, alternatively spliced. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012081349.1 | 5e-36 | MADS-box protein SVP isoform X1 | ||||
| Refseq | XP_012081350.1 | 5e-36 | MADS-box protein SVP isoform X3 | ||||
| Refseq | XP_020537901.1 | 5e-36 | MADS-box protein SVP isoform X1 | ||||
| Refseq | XP_020537902.1 | 5e-36 | MADS-box protein SVP isoform X2 | ||||
| Swissprot | Q9FUY6 | 1e-27 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
| TrEMBL | A0A067K1G2 | 1e-34 | A0A067K1G2_JATCU; Uncharacterized protein | ||||
| STRING | cassava4.1_020641m | 2e-34 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G22540.1 | 2e-29 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 105641427 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




