![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Jcr4S00157.100 | ||||||||
| Common Name | JCGZ_00716, LOC105633208 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 87aa MW: 10030.6 Da PI: 10.4372 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 61.9 | 1.3e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT eEd++l+ +++++G g+W+t ++ g++R++k+c++rw +yl
Jcr4S00157.100 14 KGPWTSEEDQKLIAYIQKHGHGRWRTLPKNAGLKRCGKSCRLRWTNYL 61
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 7.1E-28 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 25.607 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.7E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.8E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.58E-24 | 15 | 86 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 9.65E-12 | 16 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 7.6E-8 | 65 | 86 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 7.469 | 66 | 87 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
MAKSSCCDKN GLKKGPWTSE EDQKLIAYIQ KHGHGRWRTL PKNAGLKRCG KSCRLRWTNY 60 LRPDIKRGKF SVEEEDAIIQ LHSVFGK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 7e-17 | 12 | 86 | 25 | 98 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KM034724 | 3e-68 | KM034724.1 Jatropha curcas clone JcMYB104 MYB family protein gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012071180.1 | 6e-60 | transcription factor MYB34 | ||||
| Swissprot | Q9LDR8 | 3e-52 | MY102_ARATH; Transcription factor MYB102 | ||||
| TrEMBL | A0A067L4D3 | 1e-58 | A0A067L4D3_JATCU; MYB family protein | ||||
| STRING | EOY12766 | 1e-52 | (Theobroma cacao) | ||||
| STRING | XP_002525779.1 | 5e-53 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G21440.1 | 1e-54 | MYB-like 102 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 105633208 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




