![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Jcr4S00229.90 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 125aa MW: 13943 Da PI: 8.8451 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 59.7 | 1.2e-18 | 10 | 54 | 2 | 46 |
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsll 46
d++ se++Cyv+CnfCnt+lav +P + l+ +vtv+CGhC++l
Jcr4S00229.90 10 DLVPPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLS 54
78899*************************************984 PP
| |||||||
| 2 | YABBY | 86.4 | 7.8e-27 | 61 | 109 | 115 | 163 |
YABBY 115 virPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
+ Pek+ r Psaynrf+keeiqrika+nP+i hreafs+aaknWa +
Jcr4S00229.90 61 PLQAPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSTAAKNWARY 109
4688*******************************************76 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 3.0E-19 | 14 | 60 | IPR006780 | YABBY protein |
| Pfam | PF04690 | 6.9E-27 | 61 | 109 | IPR006780 | YABBY protein |
| SuperFamily | SSF47095 | 1.31E-7 | 62 | 107 | IPR009071 | High mobility group box domain |
| Gene3D | G3DSA:1.10.30.10 | 3.9E-5 | 64 | 108 | IPR009071 | High mobility group box domain |
| CDD | cd01390 | 2.61E-6 | 70 | 106 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010254 | Biological Process | nectary development | ||||
| GO:0010582 | Biological Process | floral meristem determinacy | ||||
| GO:0048479 | Biological Process | style development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 125 aa Download sequence Send to blast |
MNLEEKVTMD LVPPSEHLCY VRCNFCNTVL AVGIPCKRLL DTVTVKCGHC SNLSFLSTRP 60 PLQAPEKKHR LPSAYNRFMK EEIQRIKAAN PEIPHREAFS TAAKNWARYI PNSAGGSVSG 120 SNNND |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269|PubMed:10225997, ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:10535738, ECO:0000269|PubMed:11714690, ECO:0000269|PubMed:15598802, ECO:0000269|Ref.10}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00220 | DAP | Transfer from AT1G69180 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:15598802}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY854804 | 2e-51 | AY854804.1 Gossypium hirsutum isolate 1 CRABS CLAW mRNA, partial cds. | |||
| GenBank | AY854805 | 2e-51 | AY854805.1 Gossypium hirsutum isolate 2 CRABS CLAW mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012067816.1 | 1e-80 | protein CRABS CLAW isoform X4 | ||||
| Swissprot | Q8L925 | 9e-57 | CRC_ARATH; Protein CRABS CLAW | ||||
| TrEMBL | A0A2C9WH79 | 1e-74 | A0A2C9WH79_MANES; Uncharacterized protein | ||||
| TrEMBL | B9REB6 | 6e-75 | B9REB6_RICCO; Protein CRABS CLAW, putative | ||||
| STRING | cassava4.1_023863m | 2e-75 | (Manihot esculenta) | ||||
| STRING | XP_002512055.1 | 9e-76 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF10259 | 30 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69180.1 | 5e-56 | YABBY family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




