![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Jcr4S00455.30 | ||||||||
| Common Name | JCGZ_25591 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 10274.9 Da PI: 10.3825 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 69.1 | 7.2e-22 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd+ll+++vk++G g+W++++r+ g++R++k+c++rw +yl
Jcr4S00455.30 14 KGPWTPEEDKLLAEYVKLHGEGRWSSVSRCSGLNRSGKSCRLRWVNYL 61
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 23.529 | 9 | 65 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.5E-23 | 10 | 64 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 8.4E-18 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.1E-20 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 4.7E-23 | 15 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.29E-12 | 16 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.6E-7 | 65 | 88 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MMMGWRVPEQ VWRKGPWTPE EDKLLAEYVK LHGEGRWSSV SRCSGLNRSG KSCRLRWVNY 60 LRPGLKRGQI TPQEEGIIIE LHALWGNK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 1e-13 | 7 | 88 | 2 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. {ECO:0000305}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16531467}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KM034650 | 4e-70 | KM034650.1 Jatropha curcas clone JcMYB030 MYB family protein gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012088161.2 | 2e-58 | transcription factor MYB59 | ||||
| Swissprot | Q4JL84 | 9e-33 | MYB59_ARATH; Transcription factor MYB59 | ||||
| TrEMBL | A0A067JWC7 | 2e-55 | A0A067JWC7_JATCU; MYB family protein | ||||
| STRING | Solyc02g089190.1.1 | 7e-50 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G30210.1 | 2e-46 | myb domain protein 121 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




