PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Jcr4S00522.30

Common Name

JCGZ_01991

Organism

Jatropha curcas

Taxonomic ID

180498

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

NF-YB

Protein Properties

Length: 120aa MW: 13577.1 Da PI: 8.4741

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S00522.30	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	137.4	4e-43	1	81	17	97
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 mk++lP nakisk+aket+qecvsefisfvtseas kc++e+ kt+ngdd++wa++ lGf+dy+epl+ yl++yre+eg++ Jcr4S00522.30 1 MKQILPPNAKISKEAKETIQECVSEFISFVTSEASGKCRKERGKTVNGDDICWAMGALGFDDYAEPLRRYLQRYREIEGDR 81 9******************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF00808	3.9E-19	1	55	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamily	SSF47113	1.93E-30	1	100	IPR009072	Histone-fold
Gene3D	G3DSA:1.10.20.10	1.3E-40	1	100	IPR009072	Histone-fold
PRINTS	PR00615	7.7E-18	19	37	No hit	No description
PRINTS	PR00615	7.7E-18	38	56	No hit	No description
PRINTS	PR00615	7.7E-18	57	75	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 120 aa Download sequence Send to blast
MKQILPPNAK ISKEAKETIQ ECVSEFISFV TSEASGKCRK ERGKTVNGDD ICWAMGALGF 60 DDYAEPLRRY LQRYREIEGD RANQEKGSSS NNNTITEENR APLKFDPVDK RNSSRSSRPS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-32	1	76	17	92	Transcription factor HapC (Eurofung)
4g92_B	1e-32	1	76	17	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012084241.1	2e-74	nuclear transcription factor Y subunit B-4
Swissprot	O82248	4e-42	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A067KYC6	1e-83	A0A067KYC6_JATCU; Uncharacterized protein
STRING	cassava4.1_018746m	2e-55	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF805	32	131

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	2e-44	nuclear factor Y, subunit B5

Publications ? help Back to Top
Zhang L, et al. Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress. PLoS ONE, 2014. 9(5): p. e97878 [PMID:24837971] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]