PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Jcr4S00560.110

Common Name

JCGZ_07629, LOC105638105, WRKY14

Organism

Jatropha curcas

Taxonomic ID

180498

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

WRKY

Protein Properties

Length: 164aa MW: 18584.6 Da PI: 5.364

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S00560.110	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	98.5	4.3e-31	103	161	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K vk+s++pr+YYrC+ +gCpvkk+ver+++d+k+v++tYeg Hnh+ Jcr4S00560.110 103 LDDGYKWRKYGKKIVKSSPNPRNYYRCSIEGCPVKKRVERDRDDQKYVITTYEGVHNHP 161 59********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	3.1E-33	89	161	IPR003657	WRKY domain
SuperFamily	SSF118290	4.05E-28	96	162	IPR003657	WRKY domain
PROSITE profile	PS50811	31.502	98	163	IPR003657	WRKY domain
SMART	SM00774	1.1E-34	103	162	IPR003657	WRKY domain
Pfam	PF03106	8.4E-25	104	161	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009867	Biological Process	jasmonic acid mediated signaling pathway
GO:0050832	Biological Process	defense response to fungus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 164 aa Download sequence Send to blast
MSESSSNFAP LDTPESDYGD LTNFELSEFL TFDEWVKEDD QSMLSLLPAS NDGNLVFKAL 60 VIGESGDATS SHQHLPATGE GRKEKREAKE RVAFKTKSEV EILDDGYKWR KYGKKIVKSS 120 PNPRNYYRCS IEGCPVKKRV ERDRDDQKYV ITTYEGVHNH PTAG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	6e-26	93	160	7	74	Probable WRKY transcription factor 4
2lex_A	6e-26	93	160	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00531	DAP	Transfer from AT5G26170	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC485266	1e-129	KC485266.1 Jatropha curcas WRKY transcription factor 14 (WRKY14) gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012077228.1	1e-120	probable WRKY transcription factor 50 isoform X2
Swissprot	Q8VWQ5	2e-42	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	S5CS47	1e-119	S5CS47_JATCU; WRKY transcription factor 14
STRING	cassava4.1_032004m	3e-69	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1120	34	110

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G26170.1	1e-42	WRKY DNA-binding protein 50

Link Out ? help Back to Top
Entrez Gene	105638105

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] Xiong W, et al. Genome-wide analysis of the WRKY gene family in physic nut (Jatropha curcas L.). Gene, 2013. 524(2): p. 124-32 [PMID:23644253] Zhang L, et al. Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress. PLoS ONE, 2014. 9(5): p. e97878 [PMID:24837971]