![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Jcr4S00706.20 | ||||||||
| Common Name | JCGZ_21461, LOC105649564 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 103aa MW: 11440.8 Da PI: 6.2506 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 75.8 | 7.1e-24 | 57 | 103 | 2 | 48 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48
Cq+++C+ad+++ak+yhrrhkvCe+h+kap v+v+g++qrfCqqCsr
Jcr4S00706.20 57 CQADNCTADMTDAKRYHRRHKVCEFHAKAPLVVVAGIQQRFCQQCSR 103
**********************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 1.2E-24 | 50 | 103 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 20.179 | 54 | 103 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 8.76E-23 | 55 | 103 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 4.6E-18 | 57 | 103 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MSTSKAEGKR SLKEMEDEEE EEDEEDCVGG LGFGDDDKKK KNKKGSIGSG SMPPVSCQAD 60 NCTADMTDAK RYHRRHKVCE FHAKAPLVVV AGIQQRFCQQ CSR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 3e-20 | 49 | 103 | 3 | 57 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012091635.1 | 7e-71 | squamosa promoter-binding-like protein 3 isoform X1 | ||||
| Refseq | XP_012091636.1 | 6e-71 | squamosa promoter-binding-like protein 3 isoform X2 | ||||
| Swissprot | Q38741 | 1e-29 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| TrEMBL | A0A067JLV2 | 1e-69 | A0A067JLV2_JATCU; Squamosa promoter-binding-like protein | ||||
| STRING | cassava4.1_018710m | 2e-39 | (Manihot esculenta) | ||||
| STRING | XP_002509450.1 | 2e-39 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF535 | 34 | 153 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33810.1 | 5e-22 | squamosa promoter binding protein-like 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 105649564 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




