![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Jcr4S00712.130 | ||||||||
| Common Name | JCGZ_17986 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 94aa MW: 10439.1 Da PI: 9.4067 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 81.7 | 4.9e-26 | 2 | 52 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krie+ s r+vtfskRrng++KKA EL +LCd+e+ vi+fs+ g+lye++s
Jcr4S00712.130 2 KRIEDRSSRHVTFSKRRNGLIKKARELPILCDVEIGVIVFSTGGRLYEFCS 52
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 1.57E-23 | 1 | 55 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 6.7E-26 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 25.819 | 1 | 54 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 8.2E-25 | 3 | 50 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.5E-15 | 16 | 31 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.5E-15 | 31 | 52 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 94 aa Download sequence Send to blast |
MKRIEDRSSR HVTFSKRRNG LIKKARELPI LCDVEIGVIV FSTGGRLYEF CSSGRSEKAC 60 AVGYSVFFFV IDLLSAARAL DASLDFASKN TVIC |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020539042.1 | 3e-59 | agamous-like MADS-box protein AGL13 isoform X1 | ||||
| Swissprot | A2RVQ5 | 3e-20 | AGL16_ARATH; Agamous-like MADS-box protein AGL16 | ||||
| TrEMBL | A0A067JVK4 | 9e-61 | A0A067JVK4_JATCU; Uncharacterized protein | ||||
| STRING | EOX99786 | 1e-20 | (Theobroma cacao) | ||||
| STRING | POPTR_0001s13660.1 | 4e-21 | (Populus trichocarpa) | ||||
| STRING | XP_009790268.1 | 1e-20 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G57230.1 | 1e-22 | AGAMOUS-like 16 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




