PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Jcr4S00805.50

Common Name

JCGZ_21634, LOC105649728

Organism

Jatropha curcas

Taxonomic ID

180498

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

M-type_MADS

Protein Properties

Length: 78aa MW: 9016.31 Da PI: 10.1493

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S00805.50	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	102.8	1.2e-32	24	74	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey++ Jcr4S00805.50 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN 74 79***********************************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.1E-42	16	75	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	34.132	16	76	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.03E-41	17	76	No hit	No description
SuperFamily	SSF55455	7.72E-31	17	76	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.7E-34	18	38	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	18	72	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.8E-28	25	72	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.7E-34	38	53	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.7E-34	53	74	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
MAYPSDSRET SPQRRMGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL 60 IVFSSRGRLY EYANNSLD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-23	16	78	1	63	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-23	16	78	1	63	Myocyte-specific enhancer factor 2B
1tqe_R	2e-23	16	78	1	63	Myocyte-specific enhancer factor 2B
1tqe_S	2e-23	16	78	1	63	Myocyte-specific enhancer factor 2B
6c9l_A	2e-23	16	78	1	63	Myocyte-specific enhancer factor 2B
6c9l_B	2e-23	16	78	1	63	Myocyte-specific enhancer factor 2B
6c9l_C	2e-23	16	78	1	63	Myocyte-specific enhancer factor 2B
6c9l_D	2e-23	16	78	1	63	Myocyte-specific enhancer factor 2B
6c9l_E	2e-23	16	78	1	63	Myocyte-specific enhancer factor 2B
6c9l_F	2e-23	16	78	1	63	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
UniProt	Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JF343121	1e-124	JF343121.1 Jatropha curcas AGAMOUS-like protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001292936.1	5e-49	floral homeotic protein AGAMOUS
Refseq	XP_012091860.1	5e-49	floral homeotic protein AGAMOUS isoform X1
Swissprot	Q40885	3e-43	AG_PETHY; Floral homeotic protein AGAMOUS
Swissprot	Q43585	3e-43	AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBL	F2YNG6	1e-47	F2YNG6_JATCU; AGAMOUS-like protein
STRING	EOY27872	1e-43	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	2e-41	MIKC_MADS family protein

Link Out ? help Back to Top
Entrez Gene	105649728

Publications ? help Back to Top
Immink RG, et al. Analysis of the petunia MADS-box transcription factor family. Mol. Genet. Genomics, 2003. 268(5): p. 598-606 [PMID:12589434] Zhang L, et al. Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress. PLoS ONE, 2014. 9(5): p. e97878 [PMID:24837971] Cheung AY,Zhan XY,Wang H,Wu HM Organ-specific and Agamous-regulated expression and glycosylation of a pollen tube growth-promoting protein. Proc. Natl. Acad. Sci. U.S.A., 1996. 93(9): p. 3853-8 [PMID:8632979]