PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Jcr4S01780.10

Common Name

JCGZ_02496, LOC105648206

Organism

Jatropha curcas

Taxonomic ID

180498

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

MYB

Protein Properties

Length: 234aa MW: 26386.8 Da PI: 7.4755

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S01780.10	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.4	6e-17	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+++Ed++l+d++k +G g+W++ ++ g++R++k+c++rw +yl Jcr4S01780.10 13 KGAWSKQEDQILIDYIKTHGEGCWRSLPKAAGLHRCGKSCRLRWINYL 60 79********************************************97 PP
2	Myb_DNA-binding	53.2	7e-17	66	111	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l Jcr4S01780.10 66 RGNFGQDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 111 899*****************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.7E-24	4	62	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.634	8	60	IPR017930	Myb domain
SuperFamily	SSF46689	1.53E-28	11	107	IPR009057	Homeodomain-like
SMART	SM00717	2.2E-14	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	4.0E-15	13	60	IPR001005	SANT/Myb domain
CDD	cd00167	3.38E-11	15	60	No hit	No description
PROSITE profile	PS51294	25.902	61	115	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	8.1E-26	63	115	IPR009057	Homeodomain-like
SMART	SM00717	9.6E-16	65	113	IPR001005	SANT/Myb domain
Pfam	PF00249	2.3E-15	66	111	IPR001005	SANT/Myb domain
CDD	cd00167	2.77E-11	68	111	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 234 aa Download sequence Send to blast
MRKPCCDKEG NNKGAWSKQE DQILIDYIKT HGEGCWRSLP KAAGLHRCGK SCRLRWINYL 60 RPDIKRGNFG QDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH LRKKLMKMGI 120 DPNNHRLNQI LPRPPQPDHL SNSNTPTLDV VHSCKPNKES CNNNVDGVSD DAASSLEEDE 180 TTTTTASFDL NLDLTIAAPS PTHITTIQSR PDNCKMTSFN EVETETSPSL LLFL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	4e-27	12	115	26	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KM034675	0.0	KM034675.1 Jatropha curcas clone JcMYB055 MYB family protein gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012089912.1	1e-175	transcription factor MYB3
Swissprot	Q9S9K9	3e-75	MYB3_ARATH; Transcription factor MYB3
Swissprot	Q9SZP1	4e-75	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A067JT03	1e-173	A0A067JT03_JATCU; MYB family protein
STRING	cassava4.1_015610m	1e-115	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF264	34	221

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	1e-75	myb domain protein 3

Link Out ? help Back to Top
Entrez Gene	105648206

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhang L, et al. Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress. PLoS ONE, 2014. 9(5): p. e97878 [PMID:24837971] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]