![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Jcr4S01955.60 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 135aa MW: 14273.1 Da PI: 9.9865 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 77.5 | 2e-24 | 71 | 119 | 1 | 49 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49
+CqvegC++dls+ak y++rhkvC +hsk+p+v+v+gleqrfCqqCsr
Jcr4S01955.60 71 RCQVEGCKVDLSDAKAYYSRHKVCGMHSKSPKVIVAGLEQRFCQQCSRL 119
6**********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 2.7E-26 | 64 | 119 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 18.537 | 69 | 135 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 8.37E-24 | 69 | 120 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 4.3E-19 | 72 | 119 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 135 aa Download sequence Send to blast |
MGSGSFTESG DSSPSSPPVE CINGLKFGKK IYFENAGTGA GAPVKSTTGS SSSGSGASAR 60 KVHGGQQQPP RCQVEGCKVD LSDAKAYYSR HKVCGMHSKS PKVIVAGLEQ RFCQQCSRLR 120 YKWRGRDVVV ALNVS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 9e-15 | 72 | 119 | 11 | 58 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR157. {ECO:0000305|PubMed:12202040}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012087743.1 | 1e-78 | squamosa promoter-binding-like protein 9 | ||||
| Refseq | XP_012087744.1 | 1e-78 | squamosa promoter-binding-like protein 9 | ||||
| Swissprot | A2X0Q6 | 1e-25 | SPL3_ORYSI; Squamosa promoter-binding-like protein 3 | ||||
| Swissprot | A3A2Z8 | 1e-25 | SPL3_ORYSJ; Squamosa promoter-binding-like protein 3 | ||||
| Swissprot | Q9M2Q6 | 1e-25 | SPL15_ARATH; Squamosa promoter-binding-like protein 15 | ||||
| TrEMBL | A0A2C9V7F5 | 1e-53 | A0A2C9V7F5_MANES; Uncharacterized protein | ||||
| STRING | cassava4.1_032031m | 3e-56 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF4208 | 33 | 59 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G57920.1 | 7e-26 | squamosa promoter binding protein-like 15 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




