![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Jcr4S03172.20 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 61aa MW: 7332.81 Da PI: 10.6332 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 56.4 | 9.6e-18 | 9 | 46 | 1 | 39 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpyl 39
+ep+YVNaKQy++Il+RR +Rak+e ekkl +k rk y+
Jcr4S03172.20 9 EEPVYVNAKQYHGILRRRRSRAKAELEKKL-IKVRKVYI 46
69****************************.*****997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 5.6E-9 | 7 | 58 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 17.093 | 8 | 61 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 2.8E-13 | 10 | 46 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 13 | 33 | IPR018362 | CCAAT-binding factor, conserved site |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
MVLPLEMTEE PVYVNAKQYH GILRRRRSRA KAELEKKLIK VRKVYICACP SIFKFSNFRL 60 Y |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012086116.1 | 1e-22 | nuclear transcription factor Y subunit A-10 isoform X1 | ||||
| Refseq | XP_012086117.1 | 1e-22 | nuclear transcription factor Y subunit A-10 isoform X1 | ||||
| Swissprot | Q9LXV5 | 5e-17 | NFYA1_ARATH; Nuclear transcription factor Y subunit A-1 | ||||
| TrEMBL | A0A067K2I8 | 3e-21 | A0A067K2I8_JATCU; Uncharacterized protein | ||||
| STRING | cassava4.1_012382m | 1e-21 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF4012 | 34 | 61 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G12840.4 | 2e-19 | nuclear factor Y, subunit A1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




