PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Jcr4S04094.20

Common Name

JCGZ_07604

Organism

Jatropha curcas

Taxonomic ID

180498

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

MYB

Protein Properties

Length: 201aa MW: 23507.7 Da PI: 9.4889

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S04094.20	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	58.6	1.4e-18	17	64	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l+++++ +G+++W++ a++ g++R++k+c++rw +yl Jcr4S04094.20 17 RGAWTAEEDQKLAQVIEVHGPRRWRSLAAKAGLHRCGKSCRLRWMNYL 64 89********************************************97 PP
2	Myb_DNA-binding	50.8	3.9e-16	70	115	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Jcr4S04094.20 70 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 115 78999***************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	18.325	12	64	IPR017930	Myb domain
SMART	SM00717	1.1E-14	16	66	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.06E-29	16	111	IPR009057	Homeodomain-like
Pfam	PF00249	2.7E-17	17	64	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.8E-24	18	71	IPR009057	Homeodomain-like
CDD	cd00167	3.18E-10	19	64	No hit	No description
PROSITE profile	PS51294	25.672	65	119	IPR017930	Myb domain
SMART	SM00717	1.9E-15	69	117	IPR001005	SANT/Myb domain
Pfam	PF00249	1.6E-14	70	115	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.0E-25	72	119	IPR009057	Homeodomain-like
CDD	cd00167	1.51E-9	74	115	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 201 aa Download sequence Send to blast
MSIAPLSSKF TKREAIRGAW TAEEDQKLAQ VIEVHGPRRW RSLAAKAGLH RCGKSCRLRW 60 MNYLRPNIKR GNISDQEEDL ILRLHKLLGN RWSLIAGRLP GRTDNEIKNY WNSHLSKKIR 120 QNEKKIIRKS TTSQQSSESE KSEVVMQMNV FAKESEEGSQ KRHYDEDLSK SSFDFCSEEE 180 PLSLEWMSQF LELDQTWLDL L

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	3e-31	14	119	1	105	MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269\|PubMed:10589676, ECO:0000269\|PubMed:11585796, ECO:0000269\|PubMed:14627722, ECO:0000269\|PubMed:15361138, ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16207757}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:16176989}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KM034682	0.0	KM034682.1 Jatropha curcas clone JcMYB062 MYB family protein gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020536613.1	1e-147	transcription factor MYB114
Swissprot	Q9SEI0	4e-54	WER_ARATH; Transcription factor WER
TrEMBL	A0A067KG86	1e-146	A0A067KG86_JATCU; MYB family protein
STRING	POPTR_0006s23780.1	3e-92	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2148	32	88

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G13540.1	2e-53	myb domain protein 5

Publications ? help Back to Top
Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Cheng Y, et al. Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases. Elife, 2018. [PMID:24771765] Zhang L, et al. Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress. PLoS ONE, 2014. 9(5): p. e97878 [PMID:24837971] Kiefer CS, et al. Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity. Development, 2015. 142(5): p. 1022 [PMID:25715402] Kwak SH,Song SK,Lee MM,Schiefelbein J TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(12): p. e1103407 [PMID:26451798] Zhu Y, et al. The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development. Plant Cell, 2017. 29(2): p. 260-276 [PMID:28138017] Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] Mira MM, et al. Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit. J. Exp. Bot., 2017. 68(20): p. 5653-5668 [PMID:29059380] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308]