PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Jcr4S05658.10

Common Name

JCGZ_08592, LOC105635555

Organism

Jatropha curcas

Taxonomic ID

180498

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

LBD

Protein Properties

Length: 59aa MW: 6485.56 Da PI: 9.9547

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S05658.10	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	74.8	1.7e-23	13	59	1	47
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47 +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l+ Jcr4S05658.10 13 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQ 59 7********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	18.239	12	59	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	1.4E-22	13	59	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
MKEGGRKQGA ASPCAACKLL RRRCAQDCVF APYFPADEPQ KFANVHKVFG ASNVNKMLQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	2e-23	9	58	7	56	LOB family transfactor Ramosa2.1
5ly0_B	2e-23	9	58	7	56	LOB family transfactor Ramosa2.1
Search in ModeBase

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	GQ394806	1e-44	GQ394806.1 Gossypium hirsutum cultivar Delta Opal clone MONCS1829 SSR marker DPL0016 genomic sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012074020.1	3e-37	LOB domain-containing protein 4
Swissprot	Q9SHE9	2e-35	LBD4_ARATH; LOB domain-containing protein 4
TrEMBL	A0A067KK06	6e-36	A0A067KK06_JATCU; Uncharacterized protein
STRING	cassava4.1_023995m	6e-36	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1334	34	105

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G31320.1	9e-38	LOB domain-containing protein 4

Link Out ? help Back to Top
Entrez Gene	105635555

Publications ? help Back to Top
Zhang L, et al. Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress. PLoS ONE, 2014. 9(5): p. e97878 [PMID:24837971]