PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Jcr4S06088.30

Common Name

JCGZ_12483

Organism

Jatropha curcas

Taxonomic ID

180498

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

M-type_MADS

Protein Properties

Length: 92aa MW: 10810.6 Da PI: 9.629

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S06088.30	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	78.3	5.7e-25	9	57	1	49
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 k+ien + r++tf+kR+ gi+KKA+ELS+LCd+e+a+i+fs+ gkl+ y Jcr4S06088.30 9 KKIENPTYRHITFAKRKSGIIKKAYELSTLCDIEIALIVFSPAGKLFLY 57 78*******************************************9866 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.3E-30	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	26.534	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.84E-28	2	80	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.8E-23	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.5E-23	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.8E-23	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.8E-23	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 92 aa Download sequence Send to blast
MGRSKIILKK IENPTYRHIT FAKRKSGIIK KAYELSTLCD IEIALIVFSP AGKLFLYEGK 60 KRLEEIIDHY FDLPDNQRQR YENYNSITSD LV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	7e-17	1	57	1	57	Myocyte-specific enhancer factor 2B
1tqe_Q	7e-17	1	57	1	57	Myocyte-specific enhancer factor 2B
1tqe_R	7e-17	1	57	1	57	Myocyte-specific enhancer factor 2B
1tqe_S	7e-17	1	57	1	57	Myocyte-specific enhancer factor 2B
6byy_A	8e-17	1	57	1	57	MEF2 CHIMERA
6byy_B	8e-17	1	57	1	57	MEF2 CHIMERA
6byy_C	8e-17	1	57	1	57	MEF2 CHIMERA
6byy_D	8e-17	1	57	1	57	MEF2 CHIMERA
6bz1_A	9e-17	1	57	1	57	MEF2 CHIMERA
6bz1_B	9e-17	1	57	1	57	MEF2 CHIMERA
6bz1_C	9e-17	1	57	1	57	MEF2 CHIMERA
6bz1_D	9e-17	1	57	1	57	MEF2 CHIMERA
6c9l_A	7e-17	1	57	1	57	Myocyte-specific enhancer factor 2B
6c9l_B	7e-17	1	57	1	57	Myocyte-specific enhancer factor 2B
6c9l_C	7e-17	1	57	1	57	Myocyte-specific enhancer factor 2B
6c9l_D	7e-17	1	57	1	57	Myocyte-specific enhancer factor 2B
6c9l_E	7e-17	1	57	1	57	Myocyte-specific enhancer factor 2B
6c9l_F	7e-17	1	57	1	57	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269\|PubMed:19211705}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020537267.1	1e-53	agamous-like MADS-box protein AGL104
Swissprot	Q9LM46	2e-25	AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBL	A0A067K7C6	6e-59	A0A067K7C6_JATCU; Uncharacterized protein
STRING	Gorai.007G219600.1	4e-35	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G77950.2	3e-30	AGAMOUS-like 67

Publications ? help Back to Top
Zhang L, et al. Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress. PLoS ONE, 2014. 9(5): p. e97878 [PMID:24837971] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]