PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Jcr4S06166.60

Organism

Jatropha curcas

Taxonomic ID

180498

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha

Family

M-type_MADS

Protein Properties

Length: 66aa MW: 7481.75 Da PI: 10.6689

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Jcr4S06166.60	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	104.4	3.9e-33	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ Jcr4S06166.60 9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58 79**********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.571	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.8E-41	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	6.02E-31	2	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.23E-38	2	59	No hit	No description
PRINTS	PR00404	5.6E-34	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.5E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.6E-34	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.6E-34	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 66 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSA 60 GYVSLT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	1e-21	1	61	1	61	MEF2 CHIMERA
6byy_B	1e-21	1	61	1	61	MEF2 CHIMERA
6byy_C	1e-21	1	61	1	61	MEF2 CHIMERA
6byy_D	1e-21	1	61	1	61	MEF2 CHIMERA
6bz1_A	1e-21	1	61	1	61	MEF2 CHIMERA
6bz1_B	1e-21	1	61	1	61	MEF2 CHIMERA
6bz1_C	1e-21	1	61	1	61	MEF2 CHIMERA
6bz1_D	1e-21	1	61	1	61	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Plays minor but redundant roles with MADS6 in floral development. {ECO:0000269\|PubMed:19820190}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP011963	1e-108	AP011963.1 Jatropha curcas DNA, clone: JHL05D22, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021825726.1	5e-36	agamous-like MADS-box protein AGL6 isoform X1
Refseq	XP_028117326.1	2e-36	agamous-like MADS-box protein AGL6 isoform X7
Swissprot	Q7XUN2	2e-36	MAD17_ORYSJ; MADS-box transcription factor 17
TrEMBL	A0A287EAW5	8e-37	A0A287EAW5_HORVV; Uncharacterized protein
STRING	ORGLA02G0240800.1	5e-37	(Oryza glaberrima)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45650.1	7e-38	AGAMOUS-like 6

Publications ? help Back to Top
Duan Y, et al. Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] Hu Y, et al. Interactions of OsMADS1 with Floral Homeotic Genes in Rice Flower Development. Mol Plant, 2015. 8(9): p. 1366-84 [PMID:25917758] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119]